BLASTX nr result
ID: Cinnamomum24_contig00006942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00006942 (477 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847811.1| PREDICTED: probable prefoldin subunit 5 [Amb... 57 6e-06 >ref|XP_006847811.1| PREDICTED: probable prefoldin subunit 5 [Amborella trichopoda] gi|548851116|gb|ERN09392.1| hypothetical protein AMTR_s00029p00038430 [Amborella trichopoda] Length = 149 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 477 NYDELVEVASKKKNMADEAAVILQAKLRQAAAST 376 NYD+LVEVASKKK+MADEA V+LQAKLRQAA+++ Sbjct: 116 NYDQLVEVASKKKSMADEAGVLLQAKLRQAASTS 149