BLASTX nr result
ID: Cinnamomum24_contig00006202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00006202 (601 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010688753.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 101 3e-19 ref|XP_002510641.1| conserved hypothetical protein [Ricinus comm... 101 3e-19 ref|XP_011074732.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 100 5e-19 ref|XP_009618837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 100 5e-19 ref|XP_012839215.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 100 7e-19 emb|CDP07313.1| unnamed protein product [Coffea canephora] 99 1e-18 ref|XP_006342110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 99 2e-18 ref|XP_004291308.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 99 2e-18 ref|XP_004238414.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 99 2e-18 ref|XP_008221156.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 99 2e-18 ref|XP_007017978.1| Uncharacterized protein TCM_034349 [Theobrom... 99 2e-18 ref|XP_004505703.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 99 2e-18 ref|XP_007227520.1| hypothetical protein PRUPE_ppa014487mg [Prun... 99 2e-18 ref|XP_012073682.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 98 3e-18 ref|XP_009334299.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 98 3e-18 ref|XP_008377089.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 98 3e-18 gb|KDO46516.1| hypothetical protein CISIN_1g035245mg [Citrus sin... 98 3e-18 gb|KCW68052.1| hypothetical protein EUGRSUZ_F01733 [Eucalyptus g... 98 3e-18 ref|XP_010061147.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 98 3e-18 ref|XP_006453389.1| hypothetical protein CICLE_v10010113mg [Citr... 98 3e-18 >ref|XP_010688753.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Beta vulgaris subsp. vulgaris] gi|870850563|gb|KMT02663.1| hypothetical protein BVRB_9g203400 [Beta vulgaris subsp. vulgaris] Length = 65 Score = 101 bits (251), Expect = 3e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 MTLH PKRWHS+TGKGMCA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 15 MTLHTPKRWHSVTGKGMCALMWFWVLYRAKQDGPVVLGWRHPW 57 >ref|XP_002510641.1| conserved hypothetical protein [Ricinus communis] gi|223551342|gb|EEF52828.1| conserved hypothetical protein [Ricinus communis] Length = 69 Score = 101 bits (251), Expect = 3e-19 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWHSITGKG+CA+MWFWILYRAKQDGPVVLGWRHPW Sbjct: 14 VTIHQPKRWHSITGKGLCAVMWFWILYRAKQDGPVVLGWRHPW 56 >ref|XP_011074732.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Sesamum indicum] Length = 65 Score = 100 bits (249), Expect = 5e-19 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +TLHQPKRWH++TGKG+CA+MWFWILYRAKQDGPVVLGWRHPW Sbjct: 16 VTLHQPKRWHTVTGKGLCAVMWFWILYRAKQDGPVVLGWRHPW 58 >ref|XP_009618837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Nicotiana tomentosiformis] gi|698581743|ref|XP_009777630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Nicotiana sylvestris] Length = 65 Score = 100 bits (249), Expect = 5e-19 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWHS+TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 14 ITIHQPKRWHSVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPW 56 >ref|XP_012839215.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Erythranthe guttatus] Length = 64 Score = 100 bits (248), Expect = 7e-19 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +TLHQPKRWH++TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 14 VTLHQPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPW 56 >emb|CDP07313.1| unnamed protein product [Coffea canephora] Length = 71 Score = 99.4 bits (246), Expect = 1e-18 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+H PKRWHS+TGKGMCA+MWFWILYRAKQDGPVVLGWRHPW Sbjct: 15 ITVHHPKRWHSVTGKGMCALMWFWILYRAKQDGPVVLGWRHPW 57 >ref|XP_006342110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like [Solanum tuberosum] Length = 65 Score = 99.0 bits (245), Expect = 2e-18 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWHS+TGKG+CA+MWFWILYRAK+DGPVVLGWRHPW Sbjct: 14 ITVHQPKRWHSVTGKGLCAVMWFWILYRAKKDGPVVLGWRHPW 56 >ref|XP_004291308.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Fragaria vesca subsp. vesca] Length = 70 Score = 99.0 bits (245), Expect = 2e-18 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWH++TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 14 VTVHQPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPW 56 >ref|XP_004238414.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Solanum lycopersicum] Length = 65 Score = 99.0 bits (245), Expect = 2e-18 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWHS+TGKG+CA+MWFWILYRAK+DGPVVLGWRHPW Sbjct: 14 ITVHQPKRWHSVTGKGLCAVMWFWILYRAKKDGPVVLGWRHPW 56 >ref|XP_008221156.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Prunus mume] gi|645228784|ref|XP_008221157.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Prunus mume] Length = 67 Score = 98.6 bits (244), Expect = 2e-18 Identities = 37/42 (88%), Positives = 42/42 (100%) Frame = -2 Query: 453 TLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 T+HQPKRWH++TGKGMCA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 15 TVHQPKRWHALTGKGMCAMMWFWVLYRAKQDGPVVLGWRHPW 56 >ref|XP_007017978.1| Uncharacterized protein TCM_034349 [Theobroma cacao] gi|508723306|gb|EOY15203.1| Uncharacterized protein TCM_034349 [Theobroma cacao] Length = 70 Score = 98.6 bits (244), Expect = 2e-18 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +TLH PKRWH++TGKG+CAIMWFW+LYRAKQDGPVVLGWRHPW Sbjct: 14 VTLHHPKRWHTVTGKGLCAIMWFWVLYRAKQDGPVVLGWRHPW 56 >ref|XP_004505703.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Cicer arietinum] Length = 69 Score = 98.6 bits (244), Expect = 2e-18 Identities = 35/43 (81%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWH++TGKG+CA+MWFW++YRAKQDGPVVLGWRHPW Sbjct: 17 VTIHQPKRWHTVTGKGLCAVMWFWVMYRAKQDGPVVLGWRHPW 59 >ref|XP_007227520.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica] gi|596298608|ref|XP_007227521.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica] gi|462424456|gb|EMJ28719.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica] gi|462424457|gb|EMJ28720.1| hypothetical protein PRUPE_ppa014487mg [Prunus persica] Length = 67 Score = 98.6 bits (244), Expect = 2e-18 Identities = 37/42 (88%), Positives = 42/42 (100%) Frame = -2 Query: 453 TLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 T+HQPKRWH++TGKGMCA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 15 TVHQPKRWHTLTGKGMCAMMWFWVLYRAKQDGPVVLGWRHPW 56 >ref|XP_012073682.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Jatropha curcas] Length = 66 Score = 98.2 bits (243), Expect = 3e-18 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWH++TGKG+CAIMWFW+ YRAKQDGPVVLGWRHPW Sbjct: 14 VTIHQPKRWHTVTGKGLCAIMWFWVFYRAKQDGPVVLGWRHPW 56 >ref|XP_009334299.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Pyrus x bretschneideri] Length = 63 Score = 98.2 bits (243), Expect = 3e-18 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWH++TGKGMCA+MWFW+LYRAK+DGPVVLGWRHPW Sbjct: 14 ITVHQPKRWHTLTGKGMCAVMWFWVLYRAKKDGPVVLGWRHPW 56 >ref|XP_008377089.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Malus domestica] gi|657970653|ref|XP_008377090.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Malus domestica] Length = 63 Score = 98.2 bits (243), Expect = 3e-18 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 +T+HQPKRWH++TGKGMCA+MWFW+LYRAK+DGPVVLGWRHPW Sbjct: 14 ITVHQPKRWHTLTGKGMCAVMWFWVLYRAKKDGPVVLGWRHPW 56 >gb|KDO46516.1| hypothetical protein CISIN_1g035245mg [Citrus sinensis] Length = 69 Score = 98.2 bits (243), Expect = 3e-18 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 M LH+PKRWH++TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 15 MALHRPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPW 57 >gb|KCW68052.1| hypothetical protein EUGRSUZ_F01733 [Eucalyptus grandis] Length = 82 Score = 98.2 bits (243), Expect = 3e-18 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 M+LH PKRWH++TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 16 MSLHHPKRWHAVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPW 58 >ref|XP_010061147.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Eucalyptus grandis] gi|629102581|gb|KCW68050.1| hypothetical protein EUGRSUZ_F01733 [Eucalyptus grandis] Length = 76 Score = 98.2 bits (243), Expect = 3e-18 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 M+LH PKRWH++TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 16 MSLHHPKRWHAVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPW 58 >ref|XP_006453389.1| hypothetical protein CICLE_v10010113mg [Citrus clementina] gi|567922768|ref|XP_006453390.1| hypothetical protein CICLE_v10010113mg [Citrus clementina] gi|568840431|ref|XP_006474171.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like [Citrus sinensis] gi|557556615|gb|ESR66629.1| hypothetical protein CICLE_v10010113mg [Citrus clementina] gi|557556616|gb|ESR66630.1| hypothetical protein CICLE_v10010113mg [Citrus clementina] Length = 69 Score = 98.2 bits (243), Expect = 3e-18 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 456 MTLHQPKRWHSITGKGMCAIMWFWILYRAKQDGPVVLGWRHPW 328 M LH+PKRWH++TGKG+CA+MWFW+LYRAKQDGPVVLGWRHPW Sbjct: 15 MALHRPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPW 57