BLASTX nr result
ID: Cinnamomum24_contig00006031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00006031 (731 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009406780.1| PREDICTED: mitochondrial import receptor sub... 100 1e-18 ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citr... 99 3e-18 ref|XP_012463735.1| PREDICTED: mitochondrial import receptor sub... 97 1e-17 ref|XP_006473187.1| PREDICTED: mitochondrial import receptor sub... 97 1e-17 gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -lik... 96 2e-17 ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 96 2e-17 ref|XP_009416416.1| PREDICTED: mitochondrial import receptor sub... 96 3e-17 gb|KDO51506.1| hypothetical protein CISIN_1g0351381mg [Citrus si... 96 3e-17 ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 96 3e-17 ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citr... 96 3e-17 ref|XP_012079254.1| PREDICTED: mitochondrial import receptor sub... 95 4e-17 ref|XP_006477861.1| PREDICTED: mitochondrial import receptor sub... 95 4e-17 ref|XP_008810028.1| PREDICTED: mitochondrial import receptor sub... 92 2e-16 ref|XP_004503550.1| PREDICTED: mitochondrial import receptor sub... 92 3e-16 ref|XP_002269243.1| PREDICTED: mitochondrial import receptor sub... 92 4e-16 ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prun... 90 1e-15 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 90 1e-15 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 90 2e-15 gb|AFK44684.1| unknown [Lotus japonicus] 89 2e-15 ref|XP_009344055.1| PREDICTED: mitochondrial import receptor sub... 89 3e-15 >ref|XP_009406780.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 72 Score = 100 bits (248), Expect = 1e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -1 Query: 572 PEKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 PE+RS+ C K+WSTWAMKKAKVITHYGFIPLII IGMNSEPKPQ+YQLLSPV Sbjct: 20 PEERSACKCFKEWSTWAMKKAKVITHYGFIPLIITIGMNSEPKPQLYQLLSPV 72 >ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|567884091|ref|XP_006434604.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536725|gb|ESR47843.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536726|gb|ESR47844.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] Length = 71 Score = 98.6 bits (244), Expect = 3e-18 Identities = 44/71 (61%), Positives = 54/71 (76%) Frame = -1 Query: 626 MASRVXXXXXXXXXXXXGPEKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEP 447 M+SR+ ++S DC+K+WSTWAMKKAKVITHYGFIPL+I+IGMNS+P Sbjct: 1 MSSRITLKTKGKSVKGAKDSEKSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDP 60 Query: 446 KPQVYQLLSPV 414 KPQ+YQLLSPV Sbjct: 61 KPQLYQLLSPV 71 >ref|XP_012463735.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|823261997|ref|XP_012463736.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|763814322|gb|KJB81174.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gi|763814323|gb|KJB81175.1| hypothetical protein B456_013G132400 [Gossypium raimondii] Length = 72 Score = 97.1 bits (240), Expect = 1e-17 Identities = 40/52 (76%), Positives = 50/52 (96%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 +++S+ C+K+WSTWAMKKAKV+THYGFIPL+I+IGMNSEPKPQ+YQLLSPV Sbjct: 21 DEKSTTQCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_006473187.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] gi|641865215|gb|KDO83900.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] gi|641865216|gb|KDO83901.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] Length = 71 Score = 96.7 bits (239), Expect = 1e-17 Identities = 43/71 (60%), Positives = 54/71 (76%) Frame = -1 Query: 626 MASRVXXXXXXXXXXXXGPEKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEP 447 M+SR+ ++S DC+K+WSTWAMKKAKVITHYGFIPL+I+IGMNS+P Sbjct: 1 MSSRITLKTKGKSVKGAKDSEKSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDP 60 Query: 446 KPQVYQLLSPV 414 KPQ++QLLSPV Sbjct: 61 KPQLHQLLSPV 71 >gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -like protein [Gossypium arboreum] Length = 72 Score = 96.3 bits (238), Expect = 2e-17 Identities = 40/52 (76%), Positives = 49/52 (94%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 + +S+ C+K+WSTWAMKKAKV+THYGFIPL+I+IGMNSEPKPQ+YQLLSPV Sbjct: 21 DDKSTTQCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 96.3 bits (238), Expect = 2e-17 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E S+ C+K+WSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQ+YQLLSPV Sbjct: 22 EGSSAAKCVKEWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSPV 73 >ref|XP_009416416.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 95.5 bits (236), Expect = 3e-17 Identities = 45/71 (63%), Positives = 51/71 (71%) Frame = -1 Query: 626 MASRVXXXXXXXXXXXXGPEKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEP 447 MAS V + S C+K+WSTWAMKKAKVITHYGFIPLI++IGMNSEP Sbjct: 1 MASNVSLKGKEKAGKGSKSSEERSAKCVKEWSTWAMKKAKVITHYGFIPLIVIIGMNSEP 60 Query: 446 KPQVYQLLSPV 414 KPQ+YQLLSPV Sbjct: 61 KPQLYQLLSPV 71 >gb|KDO51506.1| hypothetical protein CISIN_1g0351381mg [Citrus sinensis] Length = 72 Score = 95.5 bits (236), Expect = 3e-17 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E++S VD K+WSTW MKKAKV+THYGFIPLII+IGMNS+PKPQVYQLLSPV Sbjct: 21 EEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 95.5 bits (236), Expect = 3e-17 Identities = 38/52 (73%), Positives = 50/52 (96%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E++S++ C+K+WSTW +KKAKVITHYGFIPL+++IGMNSEPKPQ+YQLL+PV Sbjct: 24 EEKSTIQCLKEWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQLLTPV 75 >ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] gi|557544682|gb|ESR55660.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 95.5 bits (236), Expect = 3e-17 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E++S VD K+WSTW MKKAKV+THYGFIPLII+IGMNS+PKPQVYQLLSPV Sbjct: 21 EEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_012079254.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Jatropha curcas] gi|643722074|gb|KDP31953.1| hypothetical protein JCGZ_12414 [Jatropha curcas] Length = 74 Score = 95.1 bits (235), Expect = 4e-17 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E++S C+K+WSTW MKKAKV+THYGFIPLII+IGMNSEPKPQ+YQLL+PV Sbjct: 23 EEKSMAQCLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPQLYQLLTPV 74 >ref|XP_006477861.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 72 Score = 95.1 bits (235), Expect = 4e-17 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E++S +D K+WSTW MKKAKV+THYGFIPLII+IGMNS+PKPQVYQLLSPV Sbjct: 21 EEKSMIDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_008810028.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 72 Score = 92.4 bits (228), Expect = 2e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 563 RSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 RS+ C+K WSTWAMKKAKVITHYGFIPLII+IGMNSEPKPQ+ QLLSPV Sbjct: 23 RSTARCVKTWSTWAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 72 >ref|XP_004503550.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Cicer arietinum] Length = 72 Score = 92.0 bits (227), Expect = 3e-16 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E RS VDCMK+W+TW ++KAKVITHYGFIP+II+IGMNS+PKPQ+ QLLSPV Sbjct: 21 EDRSYVDCMKEWTTWGLRKAKVITHYGFIPMIILIGMNSDPKPQLSQLLSPV 72 >ref|XP_002269243.1| PREDICTED: mitochondrial import receptor subunit TOM7-2 [Vitis vinifera] Length = 73 Score = 91.7 bits (226), Expect = 4e-16 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E S+ C+K WS WA+KKAKVITHYGFIP++I+IGMNSEPKPQ+YQLLSPV Sbjct: 22 EGHSTAKCLKDWSNWALKKAKVITHYGFIPMVIIIGMNSEPKPQLYQLLSPV 73 >ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] gi|645234757|ref|XP_008223958.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] gi|462422725|gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 90.1 bits (222), Expect = 1e-15 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 ++RS +K+WSTWAMKKAKV+THYGFIPLIIVIGMNSEPKPQ+ QLLSPV Sbjct: 22 DERSVAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|734363636|gb|KHN16697.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] Length = 72 Score = 90.1 bits (222), Expect = 1e-15 Identities = 39/52 (75%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E RS+ +C+K+W+TWAM+KAKVITHYGFIPL+IVIGMNS+PKP + QLLSPV Sbjct: 21 EDRSASECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|734310475|gb|KHM99855.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] Length = 72 Score = 89.7 bits (221), Expect = 2e-15 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E RS+ +C+K+W+TWAM+KAKVITHYGFIPL+I+IGMNS+PKP + QLLSPV Sbjct: 21 EDRSASECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 89.4 bits (220), Expect = 2e-15 Identities = 36/52 (69%), Positives = 49/52 (94%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E++++ +C+K+W+TW M+KAKV+THYGFIPLII+IGMNS+PKPQ+ QLLSPV Sbjct: 21 EEKTACECLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_009344055.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 89.0 bits (219), Expect = 3e-15 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 569 EKRSSVDCMKKWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQVYQLLSPV 414 E+RS K+WSTWA+KKAKV+THYGFIPL+I+IGMNSEPKPQ+ QLLSPV Sbjct: 22 EERSVAQSFKEWSTWALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73