BLASTX nr result
ID: Cinnamomum24_contig00003750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00003750 (572 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN13096.1| hypothetical protein AMTR_s00040p00164100 [Ambore... 66 9e-09 >gb|ERN13096.1| hypothetical protein AMTR_s00040p00164100 [Amborella trichopoda] Length = 68 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -2 Query: 406 MSKFLANSWQAVETVPPRLISIDRRPTLERRLETIQEESDGQGRKGKQLVMETPSSDFAK 227 M+K L + Q +ET PPR+I +DRRP+ + RLETIQEE+DG RK +E+ S K Sbjct: 1 MAKVLGATRQTMETAPPRIIKVDRRPSFDLRLETIQEETDGNSRKDGSSGLESTSKMDFK 60 Query: 226 RRPS 215 RRPS Sbjct: 61 RRPS 64