BLASTX nr result
ID: Cinnamomum24_contig00002565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00002565 (330 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011042487.1| PREDICTED: protochlorophyllide reductase, ch... 59 1e-06 ref|XP_011042486.1| PREDICTED: protochlorophyllide reductase, ch... 59 1e-06 ref|XP_009592452.1| PREDICTED: protochlorophyllide reductase-lik... 59 1e-06 ref|XP_009378484.1| PREDICTED: protochlorophyllide reductase, ch... 59 1e-06 ref|XP_008386137.1| PREDICTED: protochlorophyllide reductase, ch... 59 1e-06 sp|Q01289.1|POR_PEA RecName: Full=Protochlorophyllide reductase,... 59 1e-06 gb|KGN55145.1| Protochlorophyllide reductase, chloroplastic [Cuc... 59 2e-06 ref|NP_001267713.1| protochlorophyllide reductase, chloroplastic... 59 2e-06 ref|XP_010099010.1| Protochlorophyllide reductase [Morus notabil... 58 2e-06 ref|XP_010242003.1| PREDICTED: protochlorophyllide reductase-lik... 58 2e-06 ref|XP_009601330.1| PREDICTED: protochlorophyllide reductase-lik... 58 2e-06 ref|XP_012084920.1| PREDICTED: protochlorophyllide reductase, ch... 58 2e-06 ref|XP_002534245.1| short-chain dehydrogenase, putative [Ricinus... 58 2e-06 ref|XP_002317511.1| NADPH-protochlorophyllide oxidoreductase fam... 58 2e-06 gb|AAF89208.1|AF279251_1 NADPH-protochlorophyllide oxidoreductas... 58 2e-06 ref|XP_007133068.1| hypothetical protein PHAVU_011G148900g [Phas... 58 2e-06 gb|AGV54253.1| NADPH-protochlorophyllide oxidoreductase [Phaseol... 58 2e-06 ref|XP_002264042.1| PREDICTED: protochlorophyllide reductase [Vi... 58 2e-06 emb|CDP05887.1| unnamed protein product [Coffea canephora] 58 3e-06 gb|KDO74131.1| hypothetical protein CISIN_1g015844mg [Citrus sin... 58 3e-06 >ref|XP_011042487.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X2 [Populus euphratica] gi|743938496|ref|XP_011013676.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X2 [Populus euphratica] Length = 399 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 370 SFENQLSQEASDAEKARKVWEVSEKLVGLA 399 >ref|XP_011042486.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X1 [Populus euphratica] gi|743938494|ref|XP_011013675.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X1 [Populus euphratica] Length = 400 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 371 SFENQLSQEASDAEKARKVWEVSEKLVGLA 400 >ref|XP_009592452.1| PREDICTED: protochlorophyllide reductase-like [Nicotiana tomentosiformis] Length = 397 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 368 SFENQLSQEASDAEKARKVWEVSEKLVGLA 397 >ref|XP_009378484.1| PREDICTED: protochlorophyllide reductase, chloroplastic [Pyrus x bretschneideri] Length = 395 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 366 SFENQLSQEASDAEKARKVWEVSEKLVGLA 395 >ref|XP_008386137.1| PREDICTED: protochlorophyllide reductase, chloroplastic-like [Malus domestica] Length = 395 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 366 SFENQLSQEASDAEKARKVWEVSEKLVGLA 395 >sp|Q01289.1|POR_PEA RecName: Full=Protochlorophyllide reductase, chloroplastic; Short=PCR; AltName: Full=NADPH-protochlorophyllide oxidoreductase; Short=POR; Flags: Precursor [Pisum sativum] gi|20830|emb|CAA44786.1| protochlorophyllide reductase [Pisum sativum] Length = 399 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 370 SFENQLSQEASDAEKARKVWEVSEKLVGLA 399 >gb|KGN55145.1| Protochlorophyllide reductase, chloroplastic [Cucumis sativus] Length = 399 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 370 SFENQLSQEASDAEKARKVWELSEKLVGLA 399 >ref|NP_001267713.1| protochlorophyllide reductase, chloroplastic [Cucumis sativus] gi|10720220|sp|Q41249.1|PORA_CUCSA RecName: Full=Protochlorophyllide reductase, chloroplastic; Short=PCR; AltName: Full=NADPH-protochlorophyllide oxidoreductase; Short=POR; Flags: Precursor [Cucumis sativus] gi|2244614|dbj|BAA21089.1| NADPH-protochlorophyllide oxidoreductase [Cucumis sativus] Length = 398 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDAEKARKVWE+SEKLVGLA Sbjct: 369 SFENQLSQEASDAEKARKVWELSEKLVGLA 398 >ref|XP_010099010.1| Protochlorophyllide reductase [Morus notabilis] gi|587887572|gb|EXB76312.1| Protochlorophyllide reductase [Morus notabilis] Length = 399 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASD+EKARKVWEISEKLVGLA Sbjct: 370 SFENQLSQEASDSEKARKVWEISEKLVGLA 399 >ref|XP_010242003.1| PREDICTED: protochlorophyllide reductase-like [Nelumbo nucifera] Length = 400 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDA+KARKVWEISEKLVGLA Sbjct: 371 SFENQLSQEASDADKARKVWEISEKLVGLA 400 >ref|XP_009601330.1| PREDICTED: protochlorophyllide reductase-like [Nicotiana tomentosiformis] Length = 397 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LS+EASDAEKARKVWEISEKLVGLA Sbjct: 368 SFENQLSEEASDAEKARKVWEISEKLVGLA 397 >ref|XP_012084920.1| PREDICTED: protochlorophyllide reductase, chloroplastic [Jatropha curcas] gi|643714522|gb|KDP27025.1| hypothetical protein JCGZ_20960 [Jatropha curcas] Length = 399 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDA+KARKVWEISEKLVGLA Sbjct: 370 SFENQLSQEASDADKARKVWEISEKLVGLA 399 >ref|XP_002534245.1| short-chain dehydrogenase, putative [Ricinus communis] gi|223525646|gb|EEF28135.1| short-chain dehydrogenase, putative [Ricinus communis] Length = 396 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDA+KARKVWEISEKLVGLA Sbjct: 367 SFENQLSQEASDADKARKVWEISEKLVGLA 396 >ref|XP_002317511.1| NADPH-protochlorophyllide oxidoreductase family protein [Populus trichocarpa] gi|222860576|gb|EEE98123.1| NADPH-protochlorophyllide oxidoreductase family protein [Populus trichocarpa] Length = 399 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SF+N+LSQEASDAEKARKVWEISEKLVGLA Sbjct: 370 SFQNQLSQEASDAEKARKVWEISEKLVGLA 399 >gb|AAF89208.1|AF279251_1 NADPH-protochlorophyllide oxidoreductase [Vigna radiata] Length = 398 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDA+KARKVWEISEKLVGLA Sbjct: 369 SFENQLSQEASDADKARKVWEISEKLVGLA 398 >ref|XP_007133068.1| hypothetical protein PHAVU_011G148900g [Phaseolus vulgaris] gi|561006068|gb|ESW05062.1| hypothetical protein PHAVU_011G148900g [Phaseolus vulgaris] Length = 397 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDA+KARKVWEISEKLVGLA Sbjct: 368 SFENQLSQEASDADKARKVWEISEKLVGLA 397 >gb|AGV54253.1| NADPH-protochlorophyllide oxidoreductase [Phaseolus vulgaris] Length = 397 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASDA+KARKVWEISEKLVGLA Sbjct: 368 SFENQLSQEASDADKARKVWEISEKLVGLA 397 >ref|XP_002264042.1| PREDICTED: protochlorophyllide reductase [Vitis vinifera] gi|297739124|emb|CBI28775.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SF+N+LSQEASDAEKARKVWEISEKLVGLA Sbjct: 370 SFQNQLSQEASDAEKARKVWEISEKLVGLA 399 >emb|CDP05887.1| unnamed protein product [Coffea canephora] Length = 392 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASD EKARKVWEISEKLVGLA Sbjct: 363 SFENQLSQEASDVEKARKVWEISEKLVGLA 392 >gb|KDO74131.1| hypothetical protein CISIN_1g015844mg [Citrus sinensis] gi|641855346|gb|KDO74132.1| hypothetical protein CISIN_1g015844mg [Citrus sinensis] Length = 358 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 328 SFENKLSQEASDAEKARKVWEISEKLVGLA 239 SFEN+LSQEASD EKARKVWEISEKLVGLA Sbjct: 329 SFENQLSQEASDVEKARKVWEISEKLVGLA 358