BLASTX nr result
ID: Cinnamomum24_contig00002505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00002505 (536 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD59911.1| aquaporin [Chimonanthus praecox] 65 5e-14 gb|ACV66985.1| plasma membrane aquaporin 1 [Hevea brasiliensis] 82 2e-13 gb|AEN95117.1| aquaporin PIP1 [Dimocarpus longan] 82 2e-13 ref|XP_008437293.1| PREDICTED: aquaporin PIP1-2 [Cucumis melo] 81 3e-13 ref|XP_007040268.1| Plasma membrane intrinsic protein 1,4 isofor... 81 3e-13 ref|XP_010089092.1| putative aquaporin PIP1-4 [Morus notabilis] ... 80 4e-13 ref|XP_011022675.1| PREDICTED: aquaporin PIP1-2 [Populus euphrat... 80 4e-13 ref|XP_002509815.1| Aquaporin PIP1.3, putative [Ricinus communis... 80 4e-13 ref|XP_006476548.1| PREDICTED: probable aquaporin PIP1-2-like is... 80 4e-13 ref|XP_006439529.1| hypothetical protein CICLE_v10021502mg [Citr... 80 4e-13 gb|ABK96216.1| unknown [Populus trichocarpa x Populus deltoides] 80 4e-13 ref|XP_002303596.1| plasma membrane aquaporin family protein [Po... 80 4e-13 emb|CAH60718.1| putative plasma membrane intrinsic protein [Popu... 80 4e-13 ref|XP_002511872.1| Aquaporin PIP1.3, putative [Ricinus communis... 80 5e-13 ref|XP_006352272.1| PREDICTED: probable aquaporin PIP-type pTOM7... 80 5e-13 ref|XP_006827580.1| PREDICTED: aquaporin PIP1-2 [Amborella trich... 80 5e-13 gb|AFH36340.1| aquaporin PIP1;2 [Quercus petraea] 80 5e-13 ref|XP_010255327.1| PREDICTED: aquaporin PIP1-2-like [Nelumbo nu... 80 7e-13 gb|ACB56912.1| aquaporin [Ananas comosus] 80 7e-13 gb|KJB20656.1| hypothetical protein B456_003G158100 [Gossypium r... 79 9e-13 >gb|ADD59911.1| aquaporin [Chimonanthus praecox] Length = 324 Score = 64.7 bits (156), Expect(2) = 5e-14 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -3 Query: 516 FLGGSLHWSCSCCSLPPDRHQGNPIQGQGLN-FNHHLSSAC 397 F G HWSC C LPPD HQGNPIQGQGLN ++HHL S C Sbjct: 259 FWVGPFHWSCPRCCLPPDSHQGNPIQGQGLNCYHHHLHSPC 299 Score = 39.3 bits (90), Expect(2) = 5e-14 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPF 498 AWDDHWIFWVGPF Sbjct: 252 AWDDHWIFWVGPF 264 >gb|ACV66985.1| plasma membrane aquaporin 1 [Hevea brasiliensis] Length = 287 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA Sbjct: 252 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 287 >gb|AEN95117.1| aquaporin PIP1 [Dimocarpus longan] Length = 299 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA Sbjct: 264 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 299 >ref|XP_008437293.1| PREDICTED: aquaporin PIP1-2 [Cucumis melo] Length = 286 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAA+YHQI+IRAIPFKARA Sbjct: 251 AWDDHWIFWVGPFIGAALAAIYHQIIIRAIPFKARA 286 >ref|XP_007040268.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao] gi|590678323|ref|XP_007040269.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao] gi|508777513|gb|EOY24769.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao] gi|508777514|gb|EOY24770.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao] Length = 287 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAA+YHQI+IRAIPFKARA Sbjct: 252 AWDDHWIFWVGPFIGAALAAIYHQIIIRAIPFKARA 287 >ref|XP_010089092.1| putative aquaporin PIP1-4 [Morus notabilis] gi|587846899|gb|EXB37339.1| putative aquaporin PIP1-4 [Morus notabilis] Length = 287 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 252 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 287 >ref|XP_011022675.1| PREDICTED: aquaporin PIP1-2 [Populus euphratica] Length = 288 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 253 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 288 >ref|XP_002509815.1| Aquaporin PIP1.3, putative [Ricinus communis] gi|223549714|gb|EEF51202.1| Aquaporin PIP1.3, putative [Ricinus communis] Length = 287 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 252 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 287 >ref|XP_006476548.1| PREDICTED: probable aquaporin PIP1-2-like isoform X1 [Citrus sinensis] gi|641857499|gb|KDO76244.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis] Length = 287 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 252 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 287 >ref|XP_006439529.1| hypothetical protein CICLE_v10021502mg [Citrus clementina] gi|557541791|gb|ESR52769.1| hypothetical protein CICLE_v10021502mg [Citrus clementina] Length = 287 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 252 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 287 >gb|ABK96216.1| unknown [Populus trichocarpa x Populus deltoides] Length = 288 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 253 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 288 >ref|XP_002303596.1| plasma membrane aquaporin family protein [Populus trichocarpa] gi|118483041|gb|ABK93430.1| unknown [Populus trichocarpa] gi|222841028|gb|EEE78575.1| plasma membrane aquaporin family protein [Populus trichocarpa] Length = 288 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 253 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 288 >emb|CAH60718.1| putative plasma membrane intrinsic protein [Populus tremula x Populus tremuloides] Length = 288 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK+RA Sbjct: 253 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSRA 288 >ref|XP_002511872.1| Aquaporin PIP1.3, putative [Ricinus communis] gi|223549052|gb|EEF50541.1| Aquaporin PIP1.3, putative [Ricinus communis] Length = 286 Score = 80.1 bits (196), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAA+YHQI+IRAIPFKARA Sbjct: 251 AWDDHWIFWVGPFIGAALAALYHQIIIRAIPFKARA 286 >ref|XP_006352272.1| PREDICTED: probable aquaporin PIP-type pTOM75-like [Solanum tuberosum] Length = 287 Score = 80.1 bits (196), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQI+IRAIPFK+RA Sbjct: 252 AWDDHWIFWVGPFIGAALAAVYHQIIIRAIPFKSRA 287 >ref|XP_006827580.1| PREDICTED: aquaporin PIP1-2 [Amborella trichopoda] gi|548832200|gb|ERM94996.1| hypothetical protein AMTR_s00009p00231200 [Amborella trichopoda] Length = 287 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFK RA Sbjct: 252 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKTRA 287 >gb|AFH36340.1| aquaporin PIP1;2 [Quercus petraea] Length = 286 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKAR 432 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKAR Sbjct: 251 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKAR 285 >ref|XP_010255327.1| PREDICTED: aquaporin PIP1-2-like [Nelumbo nucifera] Length = 286 Score = 79.7 bits (195), Expect = 7e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKAR 432 AWDDHWIFWVGPFIGAALAAVYHQI+IRAIPFKAR Sbjct: 251 AWDDHWIFWVGPFIGAALAAVYHQIIIRAIPFKAR 285 >gb|ACB56912.1| aquaporin [Ananas comosus] Length = 288 Score = 79.7 bits (195), Expect = 7e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAA+YHQ+VIRAIPFK+RA Sbjct: 253 AWDDHWIFWVGPFIGAALAAIYHQVVIRAIPFKSRA 288 >gb|KJB20656.1| hypothetical protein B456_003G158100 [Gossypium raimondii] Length = 256 Score = 79.3 bits (194), Expect = 9e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 536 AWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKARA 429 AWDDHWIFWVGPFIGAALAA+YHQI+IRAIPFK RA Sbjct: 221 AWDDHWIFWVGPFIGAALAAIYHQIIIRAIPFKTRA 256