BLASTX nr result
ID: Cinnamomum24_contig00001707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00001707 (384 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 68 2e-09 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 315 KDFDFSRLVVEMAWIMLRIDYSRLFWLLFGVFSYENHEGKPR 190 ++F + V + WIMLRIDYSRL WLLFGVFSYENHEGKPR Sbjct: 18 QEFSRQAVAVGITWIMLRIDYSRLSWLLFGVFSYENHEGKPR 59