BLASTX nr result
ID: Cinnamomum23_contig00062226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00062226 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYE98014.1| hypothetical protein EURHEDRAFT_528745 [Aspergill... 65 2e-08 gb|KJK68445.1| hypothetical protein P875_00076066 [Aspergillus p... 62 2e-07 ref|XP_001823983.1| hypothetical protein AOR_1_430094 [Aspergill... 62 2e-07 dbj|GAO90767.1| hypothetical protein AUD_9727 [Neosartorya udaga... 59 1e-06 ref|XP_749476.1| conserved hypothetical protein [Aspergillus fum... 59 1e-06 gb|EKG13182.1| Twin-arginine translocation pathway signal sequen... 58 2e-06 ref|XP_001265905.1| hypothetical protein NFIA_035760 [Neosartory... 58 2e-06 gb|KKK15888.1| hypothetical protein ARAM_006693 [Aspergillus ram... 57 4e-06 ref|XP_003834729.1| hypothetical protein LEMA_P068720.1 [Leptosp... 57 4e-06 emb|CDM33632.1| unnamed protein product [Penicillium roqueforti ... 57 5e-06 dbj|GAD93397.1| hypothetical protein PVAR5_2007 [Byssochlamys sp... 57 5e-06 gb|EKV07778.1| hypothetical protein PDIP_72270 [Penicillium digi... 57 6e-06 >gb|EYE98014.1| hypothetical protein EURHEDRAFT_528745 [Aspergillus ruber CBS 135680] Length = 261 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/67 (46%), Positives = 43/67 (64%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S+ FYTN++ D LR++L P ++ V FD YPSV R AL+ LL E Sbjct: 170 SHPVFEGFRVSKGFYTNFAGDLLRKILERLPDLKHVEFDGYPSVRRHGALMMRLLQETKV 229 Query: 55 AEKVVTF 35 +K + + Sbjct: 230 TKKQIVW 236 >gb|KJK68445.1| hypothetical protein P875_00076066 [Aspergillus parasiticus SU-1] Length = 298 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/67 (46%), Positives = 42/67 (62%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S+ FYT +S LR +L P + V FD +PSV + AL+Q LL EA Sbjct: 189 SHPVFEGFRISKNFYTEFSGGILRDVLAKMPSLEYVEFDGWPSVRKNGALMQRLLHEAKA 248 Query: 55 AEKVVTF 35 A+K + + Sbjct: 249 AKKKIAW 255 >ref|XP_001823983.1| hypothetical protein AOR_1_430094 [Aspergillus oryzae RIB40] gi|238499639|ref|XP_002381054.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|83772722|dbj|BAE62850.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220692807|gb|EED49153.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|391869307|gb|EIT78506.1| hypothetical protein Ao3042_05227 [Aspergillus oryzae 3.042] gi|635511227|gb|KDE83138.1| hypothetical protein AO1008_09669 [Aspergillus oryzae 100-8] Length = 298 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/67 (46%), Positives = 42/67 (62%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S+ FYT +S LR +L P + V FD +PSV + AL+Q LL EA Sbjct: 189 SHPVFEGFRISKNFYTEFSGGILRDVLAKMPSLEYVEFDGWPSVRKNGALMQRLLHEAKA 248 Query: 55 AEKVVTF 35 A+K + + Sbjct: 249 AKKKIAW 255 >dbj|GAO90767.1| hypothetical protein AUD_9727 [Neosartorya udagawae] Length = 281 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/65 (43%), Positives = 44/65 (67%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S FYT+++ L+++L P + +V FD YPSV++ +L++ LL EA Sbjct: 183 SHPVFEGFRISPGFYTDFAGKILKQVLERLPHVVQVEFDGYPSVSKSGSLMKRLLHEARA 242 Query: 55 AEKVV 41 A+K + Sbjct: 243 AQKKI 247 >ref|XP_749476.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66847107|gb|EAL87438.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|159128888|gb|EDP54002.1| conserved hypothetical protein [Aspergillus fumigatus A1163] gi|666432105|gb|KEY79694.1| hypothetical protein BA78_6344 [Aspergillus fumigatus var. RP-2014] gi|846911840|gb|KMK57708.1| hypothetical protein Y699_03128 [Aspergillus fumigatus Z5] Length = 279 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/65 (41%), Positives = 44/65 (67%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S FYT+++ L+++L P + +V FD YPSV++ +L++ L+ EA Sbjct: 181 SHPVFEGFRISPGFYTDFAGKILKQVLERLPHVVQVEFDGYPSVSKSGSLMKRLVYEARA 240 Query: 55 AEKVV 41 A+K + Sbjct: 241 AQKKI 245 >gb|EKG13182.1| Twin-arginine translocation pathway signal sequence [Macrophomina phaseolina MS6] Length = 305 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/67 (44%), Positives = 41/67 (61%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 S IF GFR+S+ F+T + D LR LLL P I EV FD +PSVT+ S L+ L+ + Sbjct: 211 SDEIFRGFRRSDDFFTAFCGDLLRSLLLRVPGIEEVQFDGFPSVTKDSPLMTELMRQVTV 270 Query: 55 AEKVVTF 35 K +T+ Sbjct: 271 HGKRITY 277 >ref|XP_001265905.1| hypothetical protein NFIA_035760 [Neosartorya fischeri NRRL 181] gi|119414069|gb|EAW24008.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 281 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/65 (41%), Positives = 44/65 (67%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S FYT+++ L+++L P + +V FD YPSV++ +L++ L+ EA Sbjct: 183 SHPVFEGFRISPGFYTDFAGKILKQVLERLPHVIQVEFDGYPSVSKSGSLMKRLVHEARA 242 Query: 55 AEKVV 41 A+K + Sbjct: 243 AQKKI 247 >gb|KKK15888.1| hypothetical protein ARAM_006693 [Aspergillus rambellii] gi|816340186|gb|KKK18469.1| hypothetical protein AOCH_005421 [Aspergillus ochraceoroseus] Length = 304 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/67 (41%), Positives = 43/67 (64%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR SE FY+ ++ L+++L P + V FD +PSV++ AL++ LL EA Sbjct: 190 SHPVFEGFRISEDFYSGFAGRLLQQILERLPSLTYVEFDGFPSVSKTGALMKRLLQEARA 249 Query: 55 AEKVVTF 35 A K + + Sbjct: 250 AGKTIVW 256 >ref|XP_003834729.1| hypothetical protein LEMA_P068720.1 [Leptosphaeria maculans JN3] gi|312211279|emb|CBX91364.1| hypothetical protein LEMA_P068720.1 [Leptosphaeria maculans JN3] Length = 277 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/67 (46%), Positives = 40/67 (59%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 S+ +F GFR + FYT + LR LL I EV FDAYPSV++ S LL+ LL E Sbjct: 185 SNEVFEGFRVGQNFYTEYCVGLLRALLGQVASISEVEFDAYPSVSKSSPLLKGLLEETKL 244 Query: 55 AEKVVTF 35 +K VT+ Sbjct: 245 NQKSVTW 251 >emb|CDM33632.1| unnamed protein product [Penicillium roqueforti FM164] Length = 295 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/65 (43%), Positives = 40/65 (61%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S+ +YTN+ L ++L P + +V FDA+PSV + L+ LL E Sbjct: 174 SHPVFEGFRISKDYYTNFCGKLLHQILERLPGLVQVEFDAWPSVEKNGPLMTRLLTETRD 233 Query: 55 AEKVV 41 A+K V Sbjct: 234 AQKKV 238 >dbj|GAD93397.1| hypothetical protein PVAR5_2007 [Byssochlamys spectabilis No. 5] Length = 291 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/65 (41%), Positives = 39/65 (60%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP F GFR S +YT+++ D LR++L P + EV FD +PSV + L+ LL+E Sbjct: 183 SHPAFEGFRISRDYYTSFAGDLLRQILQSLPSVSEVEFDGWPSVDKHGPLMNRLLLETRL 242 Query: 55 AEKVV 41 K + Sbjct: 243 ERKKI 247 >gb|EKV07778.1| hypothetical protein PDIP_72270 [Penicillium digitatum Pd1] gi|425770879|gb|EKV09339.1| hypothetical protein PDIG_62890 [Penicillium digitatum PHI26] Length = 291 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/65 (41%), Positives = 40/65 (61%) Frame = -3 Query: 235 SHPIFHGFRKSETFYTNWSTDTLRRLLLVAPWIREVTFDAYPSVTRQSALLQALLVEAYK 56 SHP+F GFR S+ +YTN+ L ++L P + +V FDA+PSV + L+ LL E Sbjct: 174 SHPVFEGFRISKDYYTNFCGKLLHQILERLPGLVQVEFDAWPSVEKNGHLMTRLLTETRN 233 Query: 55 AEKVV 41 A+K + Sbjct: 234 AQKKI 238