BLASTX nr result
ID: Cinnamomum23_contig00062217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00062217 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIV99569.1| hypothetical protein PV09_08747 [Verruconis gallo... 59 2e-06 >gb|KIV99569.1| hypothetical protein PV09_08747 [Verruconis gallopava] Length = 430 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 285 DEPDELDKLITEAEEVNAKLITKLMEYFETHDDPPPQAGF 166 DE + L++L EAEE+NA+LI LM YFETHD+PPP AGF Sbjct: 391 DEYEYLERLTNEAEEINAQLIQNLMAYFETHDNPPPVAGF 430