BLASTX nr result
ID: Cinnamomum23_contig00062203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00062203 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG19392.1| Homeobox [Macrophomina phaseolina MS6] 60 6e-07 ref|XP_007580526.1| putative homeobox domain-containing protein ... 60 7e-07 >gb|EKG19392.1| Homeobox [Macrophomina phaseolina MS6] Length = 769 Score = 60.1 bits (144), Expect = 6e-07 Identities = 37/78 (47%), Positives = 48/78 (61%), Gaps = 1/78 (1%) Frame = -3 Query: 232 SRRPS-STGLSEPLGDVDIQARTASDDEGFKQPGEPSSXXXXXXXXXXXXXXXASLRSAS 56 +RR S +T L++ +G+V+IQ + D GFKQP +PSS ASLRSAS Sbjct: 434 NRRDSPATALAQSMGNVEIQGQPGGDG-GFKQPDQPSSIAARRQRPRPAALGQASLRSAS 492 Query: 55 YSAGMPVSPVSNPNNLSA 2 YSAGMP SP +N +NL A Sbjct: 493 YSAGMPSSPGTNNHNLKA 510 >ref|XP_007580526.1| putative homeobox domain-containing protein [Neofusicoccum parvum UCRNP2] gi|485928380|gb|EOD52116.1| putative homeobox domain-containing protein [Neofusicoccum parvum UCRNP2] Length = 598 Score = 59.7 bits (143), Expect = 7e-07 Identities = 35/76 (46%), Positives = 46/76 (60%) Frame = -3 Query: 229 RRPSSTGLSEPLGDVDIQARTASDDEGFKQPGEPSSXXXXXXXXXXXXXXXASLRSASYS 50 R +T L++ +G+V+IQ + S D GFKQP +PSS A+LRSASYS Sbjct: 351 RDSPATALAQSMGNVEIQGQ--SGDAGFKQPDQPSSIAARRQRPRPAALGQAALRSASYS 408 Query: 49 AGMPVSPVSNPNNLSA 2 AGMP SP +N +NL A Sbjct: 409 AGMPSSPGTNNHNLKA 424