BLASTX nr result
ID: Cinnamomum23_contig00062119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00062119 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM83484.1| hypothetical protein ANO11243_014720 [fungal sp.... 90 7e-16 >dbj|GAM83484.1| hypothetical protein ANO11243_014720 [fungal sp. No.11243] Length = 340 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = -1 Query: 235 MAFALRRPFAIVQGLKQAAPPSRSIIRAFHQQSPKQPILQRFSPA-KDSGRFLSAKDVFQ 59 M FALRRPFA+ Q LKQ SR++ R+FH + PKQ RFS K+S RF SA+DVFQ Sbjct: 1 MVFALRRPFAVTQALKQLPSASRTVFRSFHHEVPKQNFFHRFSATPKESSRFASARDVFQ 60 Query: 58 RTFKRHQSQVPYNPTASG 5 +TF+R+QS YNP SG Sbjct: 61 KTFRRNQSSSSYNPVNSG 78