BLASTX nr result
ID: Cinnamomum23_contig00062077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00062077 (380 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM85614.1| hypothetical protein ANO11243_036210 [fungal sp.... 58 2e-06 gb|KEQ98706.1| hypothetical protein AUEXF2481DRAFT_36019 [Aureob... 58 2e-06 gb|KEQ85973.1| Annexin [Aureobasidium pullulans EXF-150] 58 2e-06 gb|KEQ76668.1| Annexin [Aureobasidium namibiae CBS 147.97] 58 2e-06 gb|KEQ65498.1| Annexin [Aureobasidium melanogenum CBS 110374] 58 2e-06 >dbj|GAM85614.1| hypothetical protein ANO11243_036210 [fungal sp. No.11243] Length = 413 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 110 VPNQAAPMDMSREADAIRAAMKGFGTDEKSLIAYMA 3 VPNQ PMDMSR+ADA+R+AMKGFGTDEK+LI ++ Sbjct: 98 VPNQLPPMDMSRDADALRSAMKGFGTDEKALIQILS 133 >gb|KEQ98706.1| hypothetical protein AUEXF2481DRAFT_36019 [Aureobasidium subglaciale EXF-2481] Length = 436 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 110 VPNQAAPMDMSREADAIRAAMKGFGTDEKSLIAYMA 3 VP Q APMDMSR+AD +R AMKGFGTDEK+LIA +A Sbjct: 121 VPGQVAPMDMSRQADDLRKAMKGFGTDEKALIAVLA 156 >gb|KEQ85973.1| Annexin [Aureobasidium pullulans EXF-150] Length = 437 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 110 VPNQAAPMDMSREADAIRAAMKGFGTDEKSLIAYMA 3 VP Q APMDMSR+AD +R AMKGFGTDEK+LIA +A Sbjct: 122 VPGQVAPMDMSRQADDLRKAMKGFGTDEKALIAILA 157 >gb|KEQ76668.1| Annexin [Aureobasidium namibiae CBS 147.97] Length = 433 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 110 VPNQAAPMDMSREADAIRAAMKGFGTDEKSLIAYMA 3 VP Q APMDMSR+AD +R AMKGFGTDEK+LIA +A Sbjct: 118 VPGQVAPMDMSRQADDLRKAMKGFGTDEKALIAILA 153 >gb|KEQ65498.1| Annexin [Aureobasidium melanogenum CBS 110374] Length = 424 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 110 VPNQAAPMDMSREADAIRAAMKGFGTDEKSLIAYMA 3 VP Q APMDMSR+AD +R AMKGFGTDEK+LIA +A Sbjct: 109 VPGQVAPMDMSRQADDLRKAMKGFGTDEKALIAILA 144