BLASTX nr result
ID: Cinnamomum23_contig00061940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00061940 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIR89425.1| POT family proton-dependent oligopeptide transpor... 93 6e-17 gb|KIR49919.1| POT family proton-dependent oligopeptide transpor... 93 6e-17 gb|KGB74849.1| peptide transporter [Cryptococcus gattii R265] gi... 93 6e-17 ref|XP_003194026.1| integral membrane peptide transporter [Crypt... 93 6e-17 ref|XP_570470.1| peptide transporter [Cryptococcus neoformans va... 93 8e-17 ref|XP_775663.1| hypothetical protein CNBD3920 [Cryptococcus neo... 93 8e-17 ref|XP_012049326.1| POT family proton-dependent oligopeptide tra... 93 8e-17 emb|CDZ97807.1| H /oligopeptide symporter [Xanthophyllomyces den... 86 9e-15 ref|XP_007005320.1| hypothetical protein TREMEDRAFT_32017 [Treme... 82 1e-13 gb|KLT39864.1| PTR2-domain-containing protein [Trichosporon olea... 77 4e-12 gb|KKY35856.1| putative mfs peptide [Diaporthe ampelina] 77 6e-12 gb|EJT97854.1| PTR2-domain-containing protein [Dacryopinax sp. D... 75 2e-11 ref|XP_007339618.1| putative peptide transporter [Auricularia de... 74 4e-11 gb|KJR84227.1| MFS peptide transporter [Sporothrix schenckii 109... 73 8e-11 gb|ERT03335.1| hypothetical protein HMPREF1624_01647 [Sporothrix... 73 8e-11 gb|EKC99171.1| integral membrane peptide transporter [Trichospor... 73 8e-11 gb|EJT48406.1| hypothetical protein A1Q1_02538 [Trichosporon asa... 73 8e-11 gb|EHK47530.1| hypothetical protein TRIATDRAFT_316583 [Trichoder... 73 8e-11 ref|XP_007358719.1| hypothetical protein AURDEDRAFT_177734 [Auri... 72 1e-10 ref|XP_007788955.1| putative oligopeptide transporter protein [E... 72 1e-10 >gb|KIR89425.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii IND107] Length = 631 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQ 49 ASTCD V+ V++ QI LY+LPA+GEIFVNVTSYELAYTRAPARMKGLVYALCL NQ Sbjct: 490 ASTCDTVTSVSIWAQIPLYSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQ 546 >gb|KIR49919.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii CA1280] gi|757362671|gb|KIR68488.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii CA1873] Length = 631 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQ 49 ASTCD V+ V++ QI LY+LPA+GEIFVNVTSYELAYTRAPARMKGLVYALCL NQ Sbjct: 490 ASTCDTVTSVSIWAQIPLYSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQ 546 >gb|KGB74849.1| peptide transporter [Cryptococcus gattii R265] gi|757323709|gb|KIR29783.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii LA55] gi|757330237|gb|KIR36284.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii MMRL2647] gi|757336735|gb|KIR42758.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii Ram5] gi|757369921|gb|KIR75716.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii CA1014] gi|757390338|gb|KIR95657.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii CBS 10090] gi|757396857|gb|KIS02153.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii 2001/935-1] gi|761938656|gb|KIY59439.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii 99/473] Length = 631 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQ 49 ASTCD V+ V++ QI LY+LPA+GEIFVNVTSYELAYTRAPARMKGLVYALCL NQ Sbjct: 490 ASTCDTVTSVSIWAQIPLYSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQ 546 >ref|XP_003194026.1| integral membrane peptide transporter [Cryptococcus gattii WM276] gi|317460496|gb|ADV22239.1| Integral membrane peptide transporter, putative [Cryptococcus gattii WM276] gi|757351401|gb|KIR57254.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii Ru294] gi|757375261|gb|KIR80735.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii EJB2] gi|761747125|gb|KIY35593.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii E566] gi|765281907|gb|KJE04441.1| POT family proton-dependent oligopeptide transporter [Cryptococcus gattii NT-10] Length = 631 Score = 93.2 bits (230), Expect = 6e-17 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQ 49 ASTCD V+ +++ QI LY+LPA+GEIFVNVTSYELAYTRAPARMKGLVYALCL NQ Sbjct: 490 ASTCDSVTSISIWAQIPLYSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQ 546 >ref|XP_570470.1| peptide transporter [Cryptococcus neoformans var. neoformans JEC21] gi|57226703|gb|AAW43163.1| peptide transporter, putative [Cryptococcus neoformans var. neoformans JEC21] Length = 632 Score = 92.8 bits (229), Expect = 8e-17 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQ 49 ASTCD V+ +++ QI LY+LPA+GEIFVNVTSYELAYTRAPARMKGLVYALCL NQ Sbjct: 491 ASTCDTVTSISIWAQIPLYSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQ 547 >ref|XP_775663.1| hypothetical protein CNBD3920 [Cryptococcus neoformans var. neoformans B-3501A] gi|50258327|gb|EAL21016.1| hypothetical protein CNBD3920 [Cryptococcus neoformans var. neoformans B-3501A] Length = 632 Score = 92.8 bits (229), Expect = 8e-17 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQ 49 ASTCD V+ +++ QI LY+LPA+GEIFVNVTSYELAYTRAPARMKGLVYALCL NQ Sbjct: 491 ASTCDTVTSISIWAQIPLYSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQ 547 >ref|XP_012049326.1| POT family proton-dependent oligopeptide transporter [Cryptococcus neoformans var. grubii H99] gi|405120256|gb|AFR95027.1| POT family proton-dependent oligopeptide transporter [Cryptococcus neoformans var. grubii H99] Length = 632 Score = 92.8 bits (229), Expect = 8e-17 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQ 49 ASTCD V+ +++ QI LY+LPA+GEIFVNVTSYELAYTRAPARMKGLVYALCL NQ Sbjct: 491 ASTCDTVTSISIWAQIPLYSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQ 547 >emb|CDZ97807.1| H /oligopeptide symporter [Xanthophyllomyces dendrorhous] Length = 612 Score = 85.9 bits (211), Expect = 9e-15 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 ASTCD++S VNL QI LY+LPA+GE+FVNVTSYELAYTRAPARMKGLV+A L Sbjct: 477 ASTCDELSTVNLWAQIPLYSLPAIGELFVNVTSYELAYTRAPARMKGLVFACAL 530 >ref|XP_007005320.1| hypothetical protein TREMEDRAFT_32017 [Tremella mesenterica DSM 1558] gi|392575381|gb|EIW68514.1| hypothetical protein TREMEDRAFT_32017 [Tremella mesenterica DSM 1558] Length = 624 Score = 82.0 bits (201), Expect = 1e-13 Identities = 43/74 (58%), Positives = 50/74 (67%), Gaps = 1/74 (1%) Frame = -1 Query: 219 ASTCD-DVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLANQXX 43 ASTCD VSP++L WQ+ + +PA+GEIFVN SYELAYTR+PARMKGLVYAL L N Sbjct: 482 ASTCDAGVSPISLWWQVPIICIPAVGEIFVNPVSYELAYTRSPARMKGLVYALALFNTAV 541 Query: 42 XXXXXXXXXXAITD 1 ITD Sbjct: 542 AYAISLALADVITD 555 >gb|KLT39864.1| PTR2-domain-containing protein [Trichosporon oleaginosus] Length = 628 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -1 Query: 201 VSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLAN 52 VSPV+L WQI L PA+GE+FVNVTSYELAYTR+P RMKGLVY+L L N Sbjct: 492 VSPVSLWWQIPLIIFPAIGELFVNVTSYELAYTRSPPRMKGLVYSLSLFN 541 >gb|KKY35856.1| putative mfs peptide [Diaporthe ampelina] Length = 615 Score = 76.6 bits (187), Expect = 6e-12 Identities = 33/55 (60%), Positives = 45/55 (81%) Frame = -1 Query: 222 QASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 QASTCD VSP+++ W++ + L A+ EIFVNVTSYELAY+RAP MK +V+++CL Sbjct: 474 QASTCDGVSPISVWWELPMIVLGAISEIFVNVTSYELAYSRAPGNMKSVVFSICL 528 >gb|EJT97854.1| PTR2-domain-containing protein [Dacryopinax sp. DJM-731 SS1] Length = 609 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -1 Query: 207 DDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 D V+ ++L Q+ LY+LPA+GE+FVNVTSYE+AYTRAPARMKGLVYA+ L Sbjct: 479 DGVANISLWAQVPLYSLPAIGELFVNVTSYEIAYTRAPARMKGLVYAMVL 528 >ref|XP_007339618.1| putative peptide transporter [Auricularia delicata TFB-10046 SS5] gi|393244257|gb|EJD51769.1| putative peptide transporter [Auricularia delicata TFB-10046 SS5] Length = 630 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 192 VNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYA 67 ++L WQ+ L TLPA+GEIFVNVTSYELAYTRAPARMKGLVY+ Sbjct: 501 ISLWWQVPLITLPAIGEIFVNVTSYELAYTRAPARMKGLVYS 542 >gb|KJR84227.1| MFS peptide transporter [Sporothrix schenckii 1099-18] Length = 615 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = -1 Query: 222 QASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 QASTCDDVSPV++ WQ+ L A+ EIF+NVTSYELAY RAP M+ V AL L Sbjct: 486 QASTCDDVSPVSIWWQVPNVALGAMSEIFINVTSYELAYARAPPNMRSTVVALFL 540 >gb|ERT03335.1| hypothetical protein HMPREF1624_01647 [Sporothrix schenckii ATCC 58251] Length = 588 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = -1 Query: 222 QASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 QASTCDDVSPV++ WQ+ L A+ EIF+NVTSYELAY RAP M+ V AL L Sbjct: 459 QASTCDDVSPVSIWWQVPNVALGAMSEIFINVTSYELAYARAPPNMRSTVVALFL 513 >gb|EKC99171.1| integral membrane peptide transporter [Trichosporon asahii var. asahii CBS 8904] Length = 766 Score = 72.8 bits (177), Expect = 8e-11 Identities = 40/61 (65%), Positives = 45/61 (73%), Gaps = 5/61 (8%) Frame = -1 Query: 219 ASTC-----DDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLA 55 ASTC VSPV+L QI + LPA+GEIFVNVTSYELAYTRAP M+GLVY+L L Sbjct: 617 ASTCMVDGNAGVSPVSLWLQIPVVALPAIGEIFVNVTSYELAYTRAPPSMRGLVYSLALF 676 Query: 54 N 52 N Sbjct: 677 N 677 >gb|EJT48406.1| hypothetical protein A1Q1_02538 [Trichosporon asahii var. asahii CBS 2479] Length = 764 Score = 72.8 bits (177), Expect = 8e-11 Identities = 40/61 (65%), Positives = 45/61 (73%), Gaps = 5/61 (8%) Frame = -1 Query: 219 ASTC-----DDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCLA 55 ASTC VSPV+L QI + LPA+GEIFVNVTSYELAYTRAP M+GLVY+L L Sbjct: 615 ASTCMVDGNAGVSPVSLWLQIPVVALPAIGEIFVNVTSYELAYTRAPPSMRGLVYSLALF 674 Query: 54 N 52 N Sbjct: 675 N 675 >gb|EHK47530.1| hypothetical protein TRIATDRAFT_316583 [Trichoderma atroviride IMI 206040] Length = 618 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = -1 Query: 222 QASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 QASTCDDVSP+N+ WQI L A+ E+F NVT+YELAY+R+P +K +V+AL L Sbjct: 481 QASTCDDVSPINIWWQIPNVALGAISELFCNVTAYELAYSRSPPHLKSVVFALFL 535 >ref|XP_007358719.1| hypothetical protein AURDEDRAFT_177734 [Auricularia delicata TFB-10046 SS5] gi|393225027|gb|EJD33185.1| hypothetical protein AURDEDRAFT_177734 [Auricularia delicata TFB-10046 SS5] Length = 318 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 192 VNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 V+L WQ+ + LPA+GEIFVNVTSYELAYTRAPARMKGL+YA L Sbjct: 192 VSLWWQLPMIILPAIGEIFVNVTSYELAYTRAPARMKGLIYAAVL 236 >ref|XP_007788955.1| putative oligopeptide transporter protein [Eutypa lata UCREL1] gi|471573939|gb|EMR71957.1| putative oligopeptide transporter protein [Eutypa lata UCREL1] Length = 626 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = -1 Query: 219 ASTCDDVSPVNLLWQILLYTLPALGEIFVNVTSYELAYTRAPARMKGLVYALCL 58 ASTCD+VSP+N+ WQI L A+ EIFVNVTSYELAY+RAP M+ V AL L Sbjct: 501 ASTCDEVSPINIWWQIPNVALGAISEIFVNVTSYELAYSRAPEHMRATVVALFL 554