BLASTX nr result
ID: Cinnamomum23_contig00061874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00061874 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001536178.1| chitin synthase 2 [Histoplasma capsulatum NA... 71 3e-10 gb|KKA18706.1| Chitin synthase C, partial [Rasamsonia emersonii ... 70 7e-10 gb|KGY14614.1| chitin synthase C [Paracoccidioides brasiliensis ... 70 7e-10 gb|EEH41056.2| chitin synthase [Paracoccidioides sp. 'lutzii' Pb01] 70 7e-10 ref|XP_002794797.1| chitin synthase [Paracoccidioides sp. 'lutzi... 70 7e-10 gb|EQL29890.1| chitin synthase C, variant 1 [Blastomyces dermati... 69 1e-09 gb|EQL29889.1| chitin synthase C [Blastomyces dermatitidis ATCC ... 69 1e-09 gb|EGE80313.1| chitin synthase 2 [Blastomyces dermatitidis ATCC ... 69 1e-09 ref|XP_002624361.1| chitin synthase 2 [Blastomyces dermatitidis ... 69 1e-09 emb|CRG91101.1| chitin synthase [Talaromyces islandicus] 68 3e-09 dbj|GAD98819.1| chitin synthase 2 [Byssochlamys spectabilis No. 5] 68 3e-09 gb|KMU74472.1| chitin synthase 2 [Coccidioides immitis RMSCC 3703] 67 3e-09 gb|KMM71031.1| chitin synthase 3 [Coccidioides posadasii RMSCC 3... 67 3e-09 gb|EFW17326.1| class I chitin synthase [Coccidioides posadasii s... 67 3e-09 ref|XP_001246157.1| chitin synthase C [Coccidioides immitis RS] ... 67 3e-09 ref|XP_003007925.1| chitin synthase [Verticillium alfalfae VaMs.... 67 5e-09 ref|XP_002482859.1| chitin synthase A [Talaromyces stipitatus AT... 67 5e-09 ref|XP_007283610.1| chitin synthase [Colletotrichum gloeosporioi... 67 5e-09 gb|KKZ61304.1| chitin synthase C [Emmonsia crescens UAMH 3008] 67 6e-09 gb|KKK14987.1| hypothetical protein AOCH_003418 [Aspergillus och... 67 6e-09 >ref|XP_001536178.1| chitin synthase 2 [Histoplasma capsulatum NAm1] gi|150409752|gb|EDN05192.1| chitin synthase 2 [Histoplasma capsulatum NAm1] Length = 916 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RFVGAMWFL+TRLFRGV Sbjct: 880 QRSTIYMAVVLWSVAGLSLFRFVGAMWFLITRLFRGV 916 >gb|KKA18706.1| Chitin synthase C, partial [Rasamsonia emersonii CBS 393.64] Length = 231 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 256 NQRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 N+RANIYM+VVLWSVAGLSL +F+GAMWFLV R+FRGV Sbjct: 194 NERANIYMSVVLWSVAGLSLFKFLGAMWFLVVRMFRGV 231 >gb|KGY14614.1| chitin synthase C [Paracoccidioides brasiliensis Pb03] Length = 907 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ +YMAVVLWSVAGLSL RF+GAMWFLVTRLFRGV Sbjct: 871 QRSTVYMAVVLWSVAGLSLFRFMGAMWFLVTRLFRGV 907 >gb|EEH41056.2| chitin synthase [Paracoccidioides sp. 'lutzii' Pb01] Length = 913 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ +YMAVVLWSVAGLSL RF+GAMWFLVTRLFRGV Sbjct: 877 QRSTVYMAVVLWSVAGLSLFRFMGAMWFLVTRLFRGV 913 >ref|XP_002794797.1| chitin synthase [Paracoccidioides sp. 'lutzii' Pb01] Length = 945 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ +YMAVVLWSVAGLSL RF+GAMWFLVTRLFRGV Sbjct: 909 QRSTVYMAVVLWSVAGLSLFRFMGAMWFLVTRLFRGV 945 >gb|EQL29890.1| chitin synthase C, variant 1 [Blastomyces dermatitidis ATCC 26199] gi|531979304|gb|EQL29891.1| chitin synthase C, variant 2 [Blastomyces dermatitidis ATCC 26199] Length = 900 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RFVGAMWFL+ RLFRGV Sbjct: 864 QRSTIYMAVVLWSVAGLSLFRFVGAMWFLIARLFRGV 900 >gb|EQL29889.1| chitin synthase C [Blastomyces dermatitidis ATCC 26199] Length = 918 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RFVGAMWFL+ RLFRGV Sbjct: 882 QRSTIYMAVVLWSVAGLSLFRFVGAMWFLIARLFRGV 918 >gb|EGE80313.1| chitin synthase 2 [Blastomyces dermatitidis ATCC 18188] Length = 197 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RFVGAMWFL+ RLFRGV Sbjct: 161 QRSTIYMAVVLWSVAGLSLFRFVGAMWFLIARLFRGV 197 >ref|XP_002624361.1| chitin synthase 2 [Blastomyces dermatitidis SLH14081] gi|239587494|gb|EEQ70137.1| chitin synthase 2 [Blastomyces dermatitidis SLH14081] gi|239614446|gb|EEQ91433.1| chitin synthase 2 [Blastomyces dermatitidis ER-3] Length = 900 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RFVGAMWFL+ RLFRGV Sbjct: 864 QRSTIYMAVVLWSVAGLSLFRFVGAMWFLIARLFRGV 900 >emb|CRG91101.1| chitin synthase [Talaromyces islandicus] Length = 909 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 256 NQRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 ++RANIYM+V+LWSVAGLSL++F GAMWFLV R+FRGV Sbjct: 872 DKRANIYMSVILWSVAGLSLIKFFGAMWFLVVRMFRGV 909 >dbj|GAD98819.1| chitin synthase 2 [Byssochlamys spectabilis No. 5] Length = 1002 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QRA IYMAVVLWSVAGLS+ RF+GAMWFL+ R+FRGV Sbjct: 966 QRATIYMAVVLWSVAGLSVFRFIGAMWFLIVRMFRGV 1002 >gb|KMU74472.1| chitin synthase 2 [Coccidioides immitis RMSCC 3703] Length = 914 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RF+GAMWFLV R+FRGV Sbjct: 878 QRSAIYMAVVLWSVAGLSLFRFIGAMWFLVVRMFRGV 914 >gb|KMM71031.1| chitin synthase 3 [Coccidioides posadasii RMSCC 3488] Length = 839 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RF+GAMWFLV R+FRGV Sbjct: 803 QRSAIYMAVVLWSVAGLSLFRFIGAMWFLVVRMFRGV 839 >gb|EFW17326.1| class I chitin synthase [Coccidioides posadasii str. Silveira] gi|859411553|gb|KMP05739.1| chitin synthase [Coccidioides immitis RMSCC 2394] Length = 914 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RF+GAMWFLV R+FRGV Sbjct: 878 QRSAIYMAVVLWSVAGLSLFRFIGAMWFLVVRMFRGV 914 >ref|XP_001246157.1| chitin synthase C [Coccidioides immitis RS] gi|767020827|gb|EAS34574.3| chitin synthase C [Coccidioides immitis RS] gi|875641821|gb|KMU86973.1| chitin synthase [Coccidioides immitis H538.4] Length = 914 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 QR+ IYMAVVLWSVAGLSL RF+GAMWFLV R+FRGV Sbjct: 878 QRSAIYMAVVLWSVAGLSLFRFIGAMWFLVVRMFRGV 914 >ref|XP_003007925.1| chitin synthase [Verticillium alfalfae VaMs.102] gi|261353576|gb|EEY16004.1| chitin synthase [Verticillium alfalfae VaMs.102] Length = 886 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 256 NQRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 N RANIYM VVLWSVAGLS +F+GAMWFLV R+FRGV Sbjct: 849 NARANIYMTVVLWSVAGLSAFKFIGAMWFLVVRMFRGV 886 >ref|XP_002482859.1| chitin synthase A [Talaromyces stipitatus ATCC 10500] gi|218719447|gb|EED18867.1| chitin synthase A [Talaromyces stipitatus ATCC 10500] Length = 927 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/37 (75%), Positives = 36/37 (97%) Frame = -1 Query: 253 QRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 +RA+IYM+V+LWSVAGLSL++F+GAMWFLV R+FRGV Sbjct: 891 KRADIYMSVILWSVAGLSLIKFIGAMWFLVVRMFRGV 927 >ref|XP_007283610.1| chitin synthase [Colletotrichum gloeosporioides Nara gc5] gi|429852186|gb|ELA27333.1| chitin synthase [Colletotrichum gloeosporioides Nara gc5] Length = 901 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 256 NQRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 N RANIYM+VVLWSVAGLS +F+GAMWFLV R+FRGV Sbjct: 864 NGRANIYMSVVLWSVAGLSAFKFIGAMWFLVVRMFRGV 901 >gb|KKZ61304.1| chitin synthase C [Emmonsia crescens UAMH 3008] Length = 900 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 256 NQRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 + R+ IY+AVVLWSVAGLSL RFVGA+WFL+TRLFRGV Sbjct: 863 DHRSTIYLAVVLWSVAGLSLFRFVGAVWFLITRLFRGV 900 >gb|KKK14987.1| hypothetical protein AOCH_003418 [Aspergillus ochraceoroseus] Length = 897 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 256 NQRANIYMAVVLWSVAGLSLVRFVGAMWFLVTRLFRGV 143 N+R+ IYMAVVLWSVAGLS+ +FVGAMWFLV R+FRGV Sbjct: 860 NKRSMIYMAVVLWSVAGLSIFKFVGAMWFLVVRMFRGV 897