BLASTX nr result
ID: Cinnamomum23_contig00061865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00061865 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM89767.1| hypothetical protein ANO11243_078060 [fungal sp.... 56 8e-06 >dbj|GAM89767.1| hypothetical protein ANO11243_078060 [fungal sp. No.11243] Length = 253 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = -3 Query: 264 SDAFEVPHAGFGSQAEKGPDGKALLTVEGYARPDSPTRGDTGYHGGHHERVYG 106 S+AFEVP AG+G++ E K LL EGYA DS DTGY GGH ERV+G Sbjct: 199 SEAFEVPRAGYGARYEP-QQSKELLDGEGYAVKDSHFDYDTGYRGGHAERVFG 250