BLASTX nr result
ID: Cinnamomum23_contig00061736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00061736 (295 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007778093.1| hypothetical protein W97_02001 [Coniosporium... 59 1e-06 >ref|XP_007778093.1| hypothetical protein W97_02001 [Coniosporium apollinis CBS 100218] gi|494825622|gb|EON62776.1| hypothetical protein W97_02001 [Coniosporium apollinis CBS 100218] Length = 401 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/70 (50%), Positives = 44/70 (62%) Frame = -1 Query: 211 LNIHIASTDSSPRASVALDESPESAAMGDFAATTSTRPLSVAIPKSFGAIGPYCVRRPNL 32 L + ST SSPR S D+ + + M A +RPL+VAIP++ A GPYC RRPNL Sbjct: 11 LTLQTQSTTSSPRHSGYYDDFDKKSVMS--ANYIPSRPLTVAIPRNI-AQGPYCPRRPNL 67 Query: 31 SEILANESSP 2 SEILAN + P Sbjct: 68 SEILANTAPP 77