BLASTX nr result
ID: Cinnamomum23_contig00061707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00061707 (272 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ83341.1| WSC-domain-containing protein [Aureobasidium pull... 58 2e-06 gb|KEQ91316.1| hypothetical protein AUEXF2481DRAFT_44311 [Aureob... 57 5e-06 gb|KEQ62576.1| hypothetical protein M437DRAFT_75695 [Aureobasidi... 57 6e-06 >gb|KEQ83341.1| WSC-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 299 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 272 DAEAMAHRRLSDGSIADNEDYSRRILKVTNA 180 D EAMA RR+SDGSIADNEDYSRRILKVTNA Sbjct: 269 DPEAMAQRRMSDGSIADNEDYSRRILKVTNA 299 >gb|KEQ91316.1| hypothetical protein AUEXF2481DRAFT_44311 [Aureobasidium subglaciale EXF-2481] Length = 295 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 272 DAEAMAHRRLSDGSIADNEDYSRRILKVTNA 180 D +AMA RR+SDGSIADNEDYSRRILKVTNA Sbjct: 265 DPDAMAQRRMSDGSIADNEDYSRRILKVTNA 295 >gb|KEQ62576.1| hypothetical protein M437DRAFT_75695 [Aureobasidium melanogenum CBS 110374] Length = 310 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 272 DAEAMAHRRLSDGSIADNEDYSRRILKVTNA 180 D +AMA RR+SDGSIADNEDYSRRILKVTNA Sbjct: 280 DPDAMASRRMSDGSIADNEDYSRRILKVTNA 310