BLASTX nr result
ID: Cinnamomum23_contig00061694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00061694 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71655.1| hypothetical protein VITISV_016552 [Vitis vinifera] 57 4e-06 >emb|CAN71655.1| hypothetical protein VITISV_016552 [Vitis vinifera] Length = 496 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +3 Query: 135 HSN*TALTGTYHWYQSCATMTTNKERIENLEVGLGGLQD 251 H +LTGTY WYQS TM NKERIE LEVGLGG+QD Sbjct: 50 HKAYESLTGTYQWYQSFVTMAYNKERIEALEVGLGGVQD 88