BLASTX nr result
ID: Cinnamomum23_contig00061483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00061483 (297 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009151506.1| PREDICTED: serine/threonine-protein kinase T... 67 4e-09 ref|XP_007202926.1| hypothetical protein PRUPE_ppa016266mg, part... 66 8e-09 dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polypro... 65 2e-08 gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprot... 65 2e-08 ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, part... 61 3e-07 ref|XP_007220740.1| hypothetical protein PRUPE_ppa023598mg [Prun... 61 3e-07 ref|XP_007206637.1| hypothetical protein PRUPE_ppa021001mg [Prun... 59 2e-06 ref|XP_007199279.1| hypothetical protein PRUPE_ppa022873mg [Prun... 59 2e-06 ref|XP_003600463.1| hypothetical protein MTR_3g061470 [Medicago ... 58 3e-06 ref|XP_007221411.1| hypothetical protein PRUPE_ppb015376mg [Prun... 57 4e-06 ref|XP_007220384.1| hypothetical protein PRUPE_ppa021778mg [Prun... 57 4e-06 ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, part... 57 4e-06 ref|XP_007210190.1| hypothetical protein PRUPE_ppa017790mg [Prun... 57 4e-06 gb|AAQ56407.1| putative gag-pol polyprotein [Oryza sativa Japoni... 57 5e-06 ref|NP_001063540.1| Os09g0491900 [Oryza sativa Japonica Group] g... 57 6e-06 ref|XP_010270026.1| PREDICTED: uncharacterized protein LOC104606... 56 8e-06 >ref|XP_009151506.1| PREDICTED: serine/threonine-protein kinase TIO-like, partial [Brassica rapa] Length = 1091 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINS 143 GP+++L+++NDN YVV LPEDM IS TFNVAD+ EYHA + ++YPE NS Sbjct: 1029 GPFKILRKLNDNAYVVALPEDMNISNTFNVADIYEYHA-DGVLYPEENS 1076 >ref|XP_007202926.1| hypothetical protein PRUPE_ppa016266mg, partial [Prunus persica] gi|462398457|gb|EMJ04125.1| hypothetical protein PRUPE_ppa016266mg, partial [Prunus persica] Length = 572 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINS 143 GPY+VLK+INDN YV++LP M IS TFNVADL E+H E +YP+ NS Sbjct: 501 GPYKVLKKINDNAYVMDLPSSMGISSTFNVADLHEFHDDES-IYPDDNS 548 >dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 127 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINSR 140 GP++VL++INDN YVV LP+ M IS TFNVAD+ EYHA + ++YPE N R Sbjct: 65 GPFKVLRKINDNAYVVALPKSMNISNTFNVADIHEYHA-DGVLYPEENLR 113 >gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 280 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINSR 140 GP++VL++INDN YVV LP+ M IS TFNVAD+ EYHA + ++YPE N R Sbjct: 218 GPFKVLRKINDNAYVVALPKSMNISNTFNVADIHEYHA-DGVLYPEENLR 266 >ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] gi|462395598|gb|EMJ01397.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] Length = 1057 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINS 143 GPY+VLK INDN YV+ELP+ M IS FNVADL E+ ++++YP NS Sbjct: 979 GPYKVLKRINDNAYVIELPDSMGISNIFNVADLYEF-LEDEVLYPYYNS 1026 >ref|XP_007220740.1| hypothetical protein PRUPE_ppa023598mg [Prunus persica] gi|462417202|gb|EMJ21939.1| hypothetical protein PRUPE_ppa023598mg [Prunus persica] Length = 1457 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINS 143 GPY+VLK INDN YV+ELP+ M I FNVADL E+ ++++YP+ NS Sbjct: 1371 GPYKVLKRINDNAYVIELPDSMGIFNIFNVADLYEFR-EDEVIYPDHNS 1418 >ref|XP_007206637.1| hypothetical protein PRUPE_ppa021001mg [Prunus persica] gi|462402279|gb|EMJ07836.1| hypothetical protein PRUPE_ppa021001mg [Prunus persica] Length = 590 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINS 143 GPY++LK+INDN YVV+L M IS TFNVADL ++ + ++YPE NS Sbjct: 495 GPYKILKKINDNAYVVDLSPSMEISSTFNVADLYAFN-KDDMLYPEDNS 542 >ref|XP_007199279.1| hypothetical protein PRUPE_ppa022873mg [Prunus persica] gi|462394679|gb|EMJ00478.1| hypothetical protein PRUPE_ppa022873mg [Prunus persica] Length = 777 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINSR 140 GP ++LK+INDN YVV+LP M IS +FNVADL +H + L+Y E NSR Sbjct: 674 GPSKILKKINDNAYVVDLPHSMEISSSFNVADLYAFH-EDDLLYLEDNSR 722 >ref|XP_003600463.1| hypothetical protein MTR_3g061470 [Medicago truncatula] Length = 133 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEI 149 GP++V ++INDN YVV L E M IS TFNVAD+ EYHA E L E+ Sbjct: 82 GPFKVTRKINDNAYVVALLESMNISNTFNVADIYEYHADEVLYRDEL 128 >ref|XP_007221411.1| hypothetical protein PRUPE_ppb015376mg [Prunus persica] gi|462418123|gb|EMJ22610.1| hypothetical protein PRUPE_ppb015376mg [Prunus persica] Length = 601 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = -3 Query: 283 YQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINS 143 + VLK INDN YV+ELPE M IS TFNVADL E+ E L YPE NS Sbjct: 545 FLVLKRINDNVYVIELPEYMGISNTFNVADLYEFREDEAL-YPEHNS 590 >ref|XP_007220384.1| hypothetical protein PRUPE_ppa021778mg [Prunus persica] gi|462416846|gb|EMJ21583.1| hypothetical protein PRUPE_ppa021778mg [Prunus persica] Length = 1384 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPE 170 GPY+VLK INDN YV+ELP+ M IS FNVADL E+ E Sbjct: 1312 GPYKVLKRINDNAYVIELPDSMGISNIFNVADLYEFREDE 1351 >ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] gi|462412311|gb|EMJ17360.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] Length = 1150 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPE 170 GPY+VLK INDN YV+ELP+ M IS FNVADL E+ E Sbjct: 1111 GPYKVLKRINDNAYVIELPDSMGISNIFNVADLYEFREDE 1150 >ref|XP_007210190.1| hypothetical protein PRUPE_ppa017790mg [Prunus persica] gi|462405925|gb|EMJ11389.1| hypothetical protein PRUPE_ppa017790mg [Prunus persica] Length = 1485 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPE 170 GPY+VLK INDN YV+ELP+ M IS FNVADL E+ E Sbjct: 1413 GPYKVLKRINDNAYVIELPDSMGISNIFNVADLYEFREDE 1452 >gb|AAQ56407.1| putative gag-pol polyprotein [Oryza sativa Japonica Group] Length = 1619 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINSR 140 GP+QVL++INDN Y +ELP D +SPTFN+ADL Y E E+ SR Sbjct: 1430 GPFQVLQKINDNAYKLELPADFGVSPTFNIADLKPYLGEED----ELESR 1475 >ref|NP_001063540.1| Os09g0491900 [Oryza sativa Japonica Group] gi|113631773|dbj|BAF25454.1| Os09g0491900 [Oryza sativa Japonica Group] Length = 681 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPE 170 GP++VL +INDN Y +ELPED +SPTFNVADL+ + E Sbjct: 477 GPFRVLSKINDNAYKIELPEDYGVSPTFNVADLTPFFGLE 516 >ref|XP_010270026.1| PREDICTED: uncharacterized protein LOC104606494 [Nelumbo nucifera] Length = 699 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = -3 Query: 289 GPYQVLKEINDNGYVVELPEDMAISPTFNVADLSEYHAPEQLVYPEINS 143 G Y+++K+INDN YVV+LP+ M IS TFN ADL Y L YP +S Sbjct: 583 GAYKIIKKINDNAYVVDLPDHMGISKTFNEADLHRYLPEMTLAYPSHDS 631