BLASTX nr result
ID: Cinnamomum23_contig00060773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00060773 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM90658.1| hypothetical protein ANO11243_087030 [fungal sp.... 77 6e-12 >dbj|GAM90658.1| hypothetical protein ANO11243_087030 [fungal sp. No.11243] Length = 280 Score = 76.6 bits (187), Expect = 6e-12 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = -3 Query: 161 ELNNKGKEDIIVVAWSGVGKMGAVNAGFVGAAQADVTHTLKAGTSTWISYNPS 3 +LNNK D++ V W+G G+ GAV+A FVGA QADVTH LK+ TSTWIS+NP+ Sbjct: 94 QLNNKSPNDLVAVVWAGAGQWGAVSATFVGAQQADVTHGLKSNTSTWISFNPA 146