BLASTX nr result
ID: Cinnamomum23_contig00060749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00060749 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosp... 116 7e-24 ref|XP_003715133.1| 30S ribosomal protein S14p/S29e [Magnaporthe... 115 1e-23 ref|XP_007674738.1| hypothetical protein BAUCODRAFT_155088 [Baud... 115 1e-23 gb|KEQ61616.1| ribosomal protein S14 [Aureobasidium melanogenum ... 114 2e-23 gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2... 114 2e-23 ref|XP_007683501.1| hypothetical protein COCMIDRAFT_1391 [Bipola... 114 2e-23 gb|KEQ88480.1| ribosomal protein S14 [Aureobasidium pullulans EX... 114 3e-23 ref|XP_008730373.1| 40S ribosomal protein S29 [Cladophialophora ... 114 3e-23 ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres... 113 4e-23 gb|KJY00131.1| 40S ribosomal protein S29 [Zymoseptoria brevis] 113 6e-23 gb|KEQ77900.1| ribosomal protein S14 [Aureobasidium namibiae CBS... 113 6e-23 ref|XP_008078609.1| hypothetical protein GLAREA_10368 [Glarea lo... 113 6e-23 ref|XP_008025785.1| hypothetical protein SETTUDRAFT_163319 [Seto... 113 6e-23 gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistrom... 113 6e-23 ref|XP_007834635.1| 40S ribosomal protein S29 [Pestalotiopsis fi... 112 1e-22 emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q... 112 1e-22 gb|KIN04221.1| hypothetical protein OIDMADRAFT_18249 [Oidiodendr... 112 1e-22 ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia scler... 112 1e-22 ref|XP_001552520.1| 40S ribosomal protein S29 [Botrytis cinerea ... 112 1e-22 gb|KIW86316.1| 40S ribosomal protein S29 [Fonsecaea pedrosoi CBS... 111 2e-22 >ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] gi|312216610|emb|CBX96560.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] Length = 118 Score = 116 bits (290), Expect = 7e-24 Identities = 53/63 (84%), Positives = 55/63 (87%) Frame = -1 Query: 273 TPLVSAKMSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFV 94 TP MSH+SVWYSRPRT+GKGAR CRVC H AGLIRKYGLNICRQCFREKSADIGFV Sbjct: 56 TPPQPHIMSHESVWYSRPRTYGKGARECRVCTHPAGLIRKYGLNICRQCFREKSADIGFV 115 Query: 93 KHR 85 KHR Sbjct: 116 KHR 118 >ref|XP_003715133.1| 30S ribosomal protein S14p/S29e [Magnaporthe oryzae 70-15] gi|544604595|sp|P0CT15.1|RS29_MAGO7 RecName: Full=40S ribosomal protein S29 [Magnaporthe oryzae 70-15] gi|544604597|sp|L7IM20.1|RS29_MAGOY RecName: Full=40S ribosomal protein S29 gi|59802952|gb|AAX07680.1| 40S ribosomal protein S29-like protein [Magnaporthe grisea] gi|351647466|gb|EHA55326.1| 30S ribosomal protein S14p/S29e [Magnaporthe oryzae 70-15] gi|440475624|gb|ELQ44293.1| hypothetical protein OOU_Y34scaffold00094g84 [Magnaporthe oryzae Y34] gi|440480842|gb|ELQ61483.1| hypothetical protein OOW_P131scaffold01180g11 [Magnaporthe oryzae P131] Length = 56 Score = 115 bits (287), Expect = 1e-23 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSHDSVW SRPRT+GKGARSCRVC HRAGLIRKYGL+ICRQCFREK+ADIGFVKHR Sbjct: 1 MSHDSVWNSRPRTYGKGARSCRVCTHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 >ref|XP_007674738.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] gi|449301790|gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] Length = 56 Score = 115 bits (287), Expect = 1e-23 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPR +GKGARSCRVC H+AGLIRKYGLNICRQCFREKSADIGF KHR Sbjct: 1 MSHESVWYSRPRNYGKGARSCRVCTHQAGLIRKYGLNICRQCFREKSADIGFTKHR 56 >gb|KEQ61616.1| ribosomal protein S14 [Aureobasidium melanogenum CBS 110374] Length = 56 Score = 114 bits (286), Expect = 2e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+R CRVC H+AGLIRKYGLNICRQCFREKS DIGFVKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2202] Length = 56 Score = 114 bits (286), Expect = 2e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKGAR+CRVC H+AGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 1 MSHESVWYSRPRTYGKGARACRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 56 >ref|XP_007683501.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|628217756|ref|XP_007714314.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|451995345|gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolaris maydis C5] gi|477586242|gb|ENI03327.1| hypothetical protein COCC4DRAFT_41909 [Bipolaris maydis ATCC 48331] gi|576917146|gb|EUC31379.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|576936494|gb|EUC49989.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|578488927|gb|EUN26365.1| hypothetical protein COCVIDRAFT_27200 [Bipolaris victoriae FI3] Length = 56 Score = 114 bits (286), Expect = 2e-23 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+R CRVC H AGLIRKYGLNICRQCFREKSADIGFVKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >gb|KEQ88480.1| ribosomal protein S14 [Aureobasidium pullulans EXF-150] gi|662538509|gb|KEQ95815.1| hypothetical protein AUEXF2481DRAFT_691941 [Aureobasidium subglaciale EXF-2481] Length = 56 Score = 114 bits (285), Expect = 3e-23 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+R CRVC H+AGLIRKYGLNICRQCFREKS DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKSTDIGFIKHR 56 >ref|XP_008730373.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] gi|565932207|gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] Length = 56 Score = 114 bits (285), Expect = 3e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+RSCRVC H AGLIRKYGLNICRQCFREKS DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRSCRVCTHTAGLIRKYGLNICRQCFREKSQDIGFIKHR 56 >ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres f. teres 0-1] gi|311326818|gb|EFQ92418.1| hypothetical protein PTT_10485 [Pyrenophora teres f. teres 0-1] Length = 56 Score = 113 bits (283), Expect = 4e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+R CRVC H AGLIRKYGLNICRQCFREK+ADIGFVKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|KJY00131.1| 40S ribosomal protein S29 [Zymoseptoria brevis] Length = 56 Score = 113 bits (282), Expect = 6e-23 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+R CRVC H+AGLIRKYGLNICRQCFREK+ADIGF KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHQAGLIRKYGLNICRQCFREKAADIGFTKHR 56 >gb|KEQ77900.1| ribosomal protein S14 [Aureobasidium namibiae CBS 147.97] Length = 56 Score = 113 bits (282), Expect = 6e-23 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+R CRVC H AGLIRKYGLNICRQCFREKS DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHTAGLIRKYGLNICRQCFREKSTDIGFIKHR 56 >ref|XP_008078609.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] gi|512205853|gb|EPE34674.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] Length = 56 Score = 113 bits (282), Expect = 6e-23 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVW SRPRT+GKGAR+CRVC H+AGLIRKYGLNICRQCFREK+ADIGFVKHR Sbjct: 1 MSHESVWNSRPRTYGKGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >ref|XP_008025785.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] gi|482810546|gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] Length = 56 Score = 113 bits (282), Expect = 6e-23 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPRT+GKG+R CRVC H AGLIRKYGLNICRQCFREKS DIGFVKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistroma septosporum NZE10] Length = 56 Score = 113 bits (282), Expect = 6e-23 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVWYSRPR++GKGAR CRVC H+AGLIRKYGLNICRQCFREKS+DIGF KHR Sbjct: 1 MSHESVWYSRPRSYGKGARECRVCTHKAGLIRKYGLNICRQCFREKSSDIGFTKHR 56 >ref|XP_007834635.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] gi|573060572|gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] Length = 56 Score = 112 bits (280), Expect = 1e-22 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVW SRPR++GKGAR CRVC H+AGLIRKYGLNICRQCFREKSADIGFVKHR Sbjct: 1 MSHESVWNSRPRSYGKGARQCRVCTHKAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q9C2P2 [Pyronema omphalodes CBS 100304] Length = 56 Score = 112 bits (280), Expect = 1e-22 Identities = 47/56 (83%), Positives = 55/56 (98%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 M+H++VWYSRPRT+GKG+R CRVCAH+AGLIRKYGLN+CRQCFREKSADIGFVK+R Sbjct: 1 MAHETVWYSRPRTYGKGSRQCRVCAHQAGLIRKYGLNVCRQCFREKSADIGFVKYR 56 >gb|KIN04221.1| hypothetical protein OIDMADRAFT_18249 [Oidiodendron maius Zn] Length = 56 Score = 112 bits (279), Expect = 1e-22 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVW SRPRT+GKGAR+CRVC H+AGLIRKYGLNICRQCFREK++DIGFVKHR Sbjct: 1 MSHESVWNSRPRTYGKGARACRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154701369|gb|EDO01108.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] Length = 56 Score = 112 bits (279), Expect = 1e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVW SRPRT+GKGAR CRVC H+AGLIRKYGLNICRQCFREK++DIGFVKHR Sbjct: 1 MSHESVWMSRPRTYGKGARGCRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >ref|XP_001552520.1| 40S ribosomal protein S29 [Botrytis cinerea B05.10] gi|347828118|emb|CCD43815.1| similar to 40S ribosomal protein S29 [Botrytis cinerea T4] Length = 56 Score = 112 bits (279), Expect = 1e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKHR 85 MSH+SVW SRPRT+GKG+R CRVC H+AGLIRKYGLNICRQCFREK+ADIGFVKHR Sbjct: 1 MSHESVWMSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|KIW86316.1| 40S ribosomal protein S29 [Fonsecaea pedrosoi CBS 271.37] Length = 79 Score = 111 bits (278), Expect = 2e-22 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = -1 Query: 252 MSHDSVWYSRPRTFGKGARSCRVCAHRAGLIRKYGLNICRQCFREKSADIGFVKH 88 MSH+SVWYSRPRTFGKGAR CRVC H+AGLIRKYGLNICRQCFREKS DIGF+K+ Sbjct: 1 MSHESVWYSRPRTFGKGARGCRVCTHKAGLIRKYGLNICRQCFREKSQDIGFIKN 55