BLASTX nr result
ID: Cinnamomum23_contig00060712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00060712 (286 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007690187.1| hypothetical protein COCMIDRAFT_7271 [Bipola... 65 2e-08 ref|XP_007713049.1| hypothetical protein COCCADRAFT_26888 [Bipol... 65 2e-08 gb|ENI06525.1| hypothetical protein COCC4DRAFT_165329 [Bipolaris... 65 2e-08 gb|EMD87326.1| hypothetical protein COCHEDRAFT_1197445 [Bipolari... 65 2e-08 ref|XP_007705175.1| hypothetical protein COCSADRAFT_194212 [Bipo... 65 2e-08 gb|EKG11112.1| Chitin synthase III catalytic subunit [Macrophomi... 64 3e-08 ref|XP_007777017.1| hypothetical protein W97_00916 [Coniosporium... 64 4e-08 ref|XP_007923292.1| hypothetical protein MYCFIDRAFT_88443 [Pseud... 64 4e-08 ref|XP_007580340.1| putative export control protein chs7- protei... 64 5e-08 gb|KMM64032.1| chitin synthase export chaperone [Coccidioides po... 62 1e-07 ref|XP_001248692.2| hypothetical protein CIMG_02463 [Coccidioide... 62 1e-07 gb|EFW22425.1| conserved hypothetical protein [Coccidioides posa... 62 1e-07 ref|XP_003070967.1| hypothetical protein CPC735_040860 [Coccidio... 62 1e-07 ref|XP_002845480.1| chitin synthase export chaperone [Arthroderm... 62 1e-07 gb|KKY28754.1| putative export control protein chs7 [Diplodia se... 62 1e-07 gb|KEQ79003.1| hypothetical protein M438DRAFT_378523 [Aureobasid... 62 1e-07 ref|XP_008026354.1| hypothetical protein SETTUDRAFT_169442 [Seto... 62 1e-07 gb|EHK15470.1| hypothetical protein TRIVIDRAFT_196318 [Trichoder... 61 3e-07 gb|KFA63749.1| hypothetical protein S40285_01978 [Stachybotrys c... 61 3e-07 gb|KEY64478.1| hypothetical protein S7711_07226 [Stachybotrys ch... 61 3e-07 >ref|XP_007690187.1| hypothetical protein COCMIDRAFT_7271 [Bipolaris oryzae ATCC 44560] gi|576929684|gb|EUC43286.1| hypothetical protein COCMIDRAFT_7271 [Bipolaris oryzae ATCC 44560] Length = 302 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AVVMVWVFWSSITEDDWPMP A YT Sbjct: 268 FETLFTLLAVVMVWVFWSSITEDDWPMPTVAGTYT 302 >ref|XP_007713049.1| hypothetical protein COCCADRAFT_26888 [Bipolaris zeicola 26-R-13] gi|576918435|gb|EUC32631.1| hypothetical protein COCCADRAFT_26888 [Bipolaris zeicola 26-R-13] gi|578484470|gb|EUN21994.1| hypothetical protein COCVIDRAFT_30932 [Bipolaris victoriae FI3] Length = 302 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AVVMVWVFWSSITEDDWPMP A YT Sbjct: 268 FETLFTLLAVVMVWVFWSSITEDDWPMPTVAGTYT 302 >gb|ENI06525.1| hypothetical protein COCC4DRAFT_165329 [Bipolaris maydis ATCC 48331] Length = 302 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AVVMVWVFWSSITEDDWPMP A YT Sbjct: 268 FETLFTLLAVVMVWVFWSSITEDDWPMPTVAGTYT 302 >gb|EMD87326.1| hypothetical protein COCHEDRAFT_1197445 [Bipolaris maydis C5] Length = 295 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AVVMVWVFWSSITEDDWPMP A YT Sbjct: 261 FETLFTLLAVVMVWVFWSSITEDDWPMPTVAGTYT 295 >ref|XP_007705175.1| hypothetical protein COCSADRAFT_194212 [Bipolaris sorokiniana ND90Pr] gi|451846167|gb|EMD59478.1| hypothetical protein COCSADRAFT_194212 [Bipolaris sorokiniana ND90Pr] Length = 302 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AVVMVWVFWSSITEDDWPMP A YT Sbjct: 268 FETLFTLLAVVMVWVFWSSITEDDWPMPTVAGTYT 302 >gb|EKG11112.1| Chitin synthase III catalytic subunit [Macrophomina phaseolina MS6] Length = 305 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGY 184 FET F+L AVVMVWVFWSSITEDDWPMP + GY Sbjct: 271 FETFFTLCAVVMVWVFWSSITEDDWPMPVAGGGY 304 >ref|XP_007777017.1| hypothetical protein W97_00916 [Coniosporium apollinis CBS 100218] gi|494824409|gb|EON61700.1| hypothetical protein W97_00916 [Coniosporium apollinis CBS 100218] Length = 231 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AV+ VWVFWSSITEDDWPMP + A YT Sbjct: 197 FETLFTLLAVIFVWVFWSSITEDDWPMPTAGATYT 231 >ref|XP_007923292.1| hypothetical protein MYCFIDRAFT_88443 [Pseudocercospora fijiensis CIRAD86] gi|452986046|gb|EME85802.1| hypothetical protein MYCFIDRAFT_88443 [Pseudocercospora fijiensis CIRAD86] Length = 305 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AVV +WVFWSSITEDDWPMP + AG T Sbjct: 269 FETLFTLLAVVTIWVFWSSITEDDWPMPATGAGST 303 >ref|XP_007580340.1| putative export control protein chs7- protein [Neofusicoccum parvum UCRNP2] gi|485928441|gb|EOD52148.1| putative export control protein chs7- protein [Neofusicoccum parvum UCRNP2] Length = 300 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FET F+L AVVM+WVFWSSITEDDWPMP + YT Sbjct: 266 FETFFTLCAVVMIWVFWSSITEDDWPMPVTGGAYT 300 >gb|KMM64032.1| chitin synthase export chaperone [Coccidioides posadasii RMSCC 3488] Length = 297 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGY 184 FETLF+L +V MVW+FWSSITEDDWPMP S GY Sbjct: 263 FETLFTLLSVGMVWIFWSSITEDDWPMPVSTGGY 296 >ref|XP_001248692.2| hypothetical protein CIMG_02463 [Coccidioides immitis RS] gi|767014312|gb|EAS37109.3| hypothetical protein CIMG_02463 [Coccidioides immitis RS] gi|859417208|gb|KMP10050.1| hypothetical protein CIRG_09283 [Coccidioides immitis RMSCC 2394] gi|875287425|gb|KMU81054.1| chitin synthase export chaperone [Coccidioides immitis RMSCC 3703] gi|875641102|gb|KMU86561.1| hypothetical protein CIHG_04350 [Coccidioides immitis H538.4] Length = 297 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGY 184 FETLF+L +V MVW+FWSSITEDDWPMP S GY Sbjct: 263 FETLFTLLSVGMVWIFWSSITEDDWPMPVSTGGY 296 >gb|EFW22425.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] Length = 291 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGY 184 FETLF+L +V MVW+FWSSITEDDWPMP S GY Sbjct: 257 FETLFTLLSVGMVWIFWSSITEDDWPMPVSTGGY 290 >ref|XP_003070967.1| hypothetical protein CPC735_040860 [Coccidioides posadasii C735 delta SOWgp] gi|240110664|gb|EER28822.1| hypothetical protein CPC735_040860 [Coccidioides posadasii C735 delta SOWgp] Length = 239 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGY 184 FETLF+L +V MVW+FWSSITEDDWPMP S GY Sbjct: 205 FETLFTLLSVGMVWIFWSSITEDDWPMPVSTGGY 238 >ref|XP_002845480.1| chitin synthase export chaperone [Arthroderma otae CBS 113480] gi|238842868|gb|EEQ32530.1| chitin synthase export chaperone [Arthroderma otae CBS 113480] Length = 284 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AV+MVWVFWSSITEDDWPMP S GY+ Sbjct: 251 FETLFNLGAVIMVWVFWSSITEDDWPMPVS-GGYS 284 >gb|KKY28754.1| putative export control protein chs7 [Diplodia seriata] Length = 264 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FET F+L A+ MVWVFWSSITEDDWPMP + YT Sbjct: 230 FETFFTLCAIAMVWVFWSSITEDDWPMPVTGGAYT 264 >gb|KEQ79003.1| hypothetical protein M438DRAFT_378523 [Aureobasidium pullulans EXF-150] Length = 301 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FE+LF+L AVVM+WVFWSSITEDDWP+P + YT Sbjct: 267 FESLFTLLAVVMIWVFWSSITEDDWPLPSTETTYT 301 >ref|XP_008026354.1| hypothetical protein SETTUDRAFT_169442 [Setosphaeria turcica Et28A] gi|482809250|gb|EOA86085.1| hypothetical protein SETTUDRAFT_169442 [Setosphaeria turcica Et28A] Length = 304 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGYT 181 FETLF+L AVVMVWVFWSSITEDDWPMP A T Sbjct: 268 FETLFTLLAVVMVWVFWSSITEDDWPMPTVAGSGT 302 >gb|EHK15470.1| hypothetical protein TRIVIDRAFT_196318 [Trichoderma virens Gv29-8] Length = 324 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAAGY 184 FETLF+L AV +VWVFWSSITEDDWPMP + A Y Sbjct: 256 FETLFTLLAVGLVWVFWSSITEDDWPMPATDAAY 289 >gb|KFA63749.1| hypothetical protein S40285_01978 [Stachybotrys chlorohalonata IBT 40285] Length = 298 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAA 190 F+TLF+L AVVM+WVFWSSITEDDWPMP +A Sbjct: 265 FQTLFTLLAVVMIWVFWSSITEDDWPMPTGSA 296 >gb|KEY64478.1| hypothetical protein S7711_07226 [Stachybotrys chartarum IBT 7711] gi|667520284|gb|KFA49599.1| hypothetical protein S40293_06628 [Stachybotrys chartarum IBT 40293] gi|667743540|gb|KFA81891.1| hypothetical protein S40288_01717 [Stachybotrys chartarum IBT 40288] Length = 298 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 285 FETLFSLAAVVMVWVFWSSITEDDWPMPGSAA 190 F+TLF+L AVVM+WVFWSSITEDDWPMP +A Sbjct: 265 FQTLFTLLAVVMIWVFWSSITEDDWPMPTGSA 296