BLASTX nr result
ID: Cinnamomum23_contig00060333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00060333 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM87786.1| hypothetical protein ANO11243_058140 [fungal sp.... 57 5e-06 >dbj|GAM87786.1| hypothetical protein ANO11243_058140 [fungal sp. No.11243] Length = 430 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 4/49 (8%) Frame = -2 Query: 288 YKVTVTADANGQSCTYSNGQ-YSGV---GGTGNGCTISASSGTITYTFS 154 YKVT++ G++CTY NG YS + G + NGCT+SASSGT+TY FS Sbjct: 382 YKVTLSGSDTGETCTYENGMFYSSILPGGSSSNGCTLSASSGTMTYVFS 430