BLASTX nr result
ID: Cinnamomum23_contig00060273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00060273 (291 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM88098.1| hypothetical protein ANO11243_061290 [fungal sp.... 64 5e-08 ref|XP_007920980.1| hypothetical protein MYCFIDRAFT_87587 [Pseud... 56 8e-06 >dbj|GAM88098.1| hypothetical protein ANO11243_061290 [fungal sp. No.11243] Length = 216 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 290 ISNKVEIKEGKVSDYTSEESAYKKLRTARSDARLVGV 180 I+NK E+KEGKVSD+ EE+AYKKLRTARSDARLVGV Sbjct: 164 ITNKAEVKEGKVSDFQGEENAYKKLRTARSDARLVGV 200 >ref|XP_007920980.1| hypothetical protein MYCFIDRAFT_87587 [Pseudocercospora fijiensis CIRAD86] gi|452989093|gb|EME88848.1| hypothetical protein MYCFIDRAFT_87587 [Pseudocercospora fijiensis CIRAD86] Length = 222 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 290 ISNKVEIKEGKVSDYTSEESAYKKLRTARSDARLVG 183 ISNKV IKEGK+SDY + E+AY++LR ARSDARL+G Sbjct: 169 ISNKVAIKEGKLSDYPATENAYRQLRVARSDARLIG 204