BLASTX nr result
ID: Cinnamomum23_contig00060155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00060155 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007781605.1| hypothetical protein W97_05681 [Coniosporium... 57 5e-06 >ref|XP_007781605.1| hypothetical protein W97_05681 [Coniosporium apollinis CBS 100218] gi|494829700|gb|EON66288.1| hypothetical protein W97_05681 [Coniosporium apollinis CBS 100218] Length = 616 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/68 (42%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = -1 Query: 257 GEADFMALDNNE--AAKETRLADENAALKRQISALRKIQKASLSYVEEARVRQQQLDQES 84 GEADFMALD+ E A+ +T+LADEN LK+Q+ AL+++QKA+ + + R + L + Sbjct: 470 GEADFMALDDTEGRASGDTKLADENMRLKKQLRALQRVQKATFGQIADLREEIKGLREMG 529 Query: 83 RQKSQLEN 60 R+ + E+ Sbjct: 530 RETEETED 537