BLASTX nr result
ID: Cinnamomum23_contig00059560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00059560 (352 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827235.2| PREDICTED: DNA ligase 1 [Amborella trichopoda] 60 4e-07 >ref|XP_006827235.2| PREDICTED: DNA ligase 1 [Amborella trichopoda] Length = 480 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +2 Query: 2 YHFIRENVAESIIFFKKIYTFENPAYMFTKHVPREKFKLCLDLIHVTQ 145 YH I+E V E II+ KKI+T ENPA + TK V EKFKLCLDL+++ Q Sbjct: 71 YHKIKELVLEGIIYLKKIHTNENPANILTKLVTTEKFKLCLDLLNICQ 118