BLASTX nr result
ID: Cinnamomum23_contig00059236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00059236 (363 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY24182.1| putativelike antibiotic response [Phaeomoniella c... 67 6e-09 gb|KIN01645.1| hypothetical protein OIDMADRAFT_18595 [Oidiodendr... 63 9e-08 ref|XP_003843655.1| hypothetical protein LEMA_P013060.1 [Leptosp... 62 2e-07 ref|XP_008080095.1| hypothetical protein GLAREA_06491 [Glarea lo... 62 2e-07 gb|EUN29239.1| hypothetical protein COCVIDRAFT_93521 [Bipolaris ... 60 7e-07 ref|XP_007714831.1| hypothetical protein COCCADRAFT_38960 [Bipol... 60 7e-07 gb|EMD92204.1| hypothetical protein COCHEDRAFT_1134453 [Bipolari... 59 1e-06 ref|XP_003296736.1| hypothetical protein PTT_06916 [Pyrenophora ... 59 1e-06 ref|XP_001941406.1| signal transduction protein [Pyrenophora tri... 58 2e-06 gb|ENI07897.1| hypothetical protein COCC4DRAFT_162035 [Bipolaris... 57 4e-06 ref|XP_007686474.1| hypothetical protein COCMIDRAFT_35404 [Bipol... 57 6e-06 ref|XP_008028122.1| hypothetical protein SETTUDRAFT_33331 [Setos... 56 8e-06 >gb|KKY24182.1| putativelike antibiotic response [Phaeomoniella chlamydospora] Length = 125 Score = 66.6 bits (161), Expect = 6e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQR 248 +A RHA++ A+D+YDQHY+Q+QGADQYDPNQYG P R Sbjct: 85 QAHRHAKKNAEDMYDQHYIQNQGADQYDPNQYGAPDR 121 >gb|KIN01645.1| hypothetical protein OIDMADRAFT_18595 [Oidiodendron maius Zn] Length = 130 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLEN 239 +AK HA + A+ LYD+HYV+DQGADQYDPNQY P + + N Sbjct: 88 KAKHHARENAEHLYDEHYVRDQGADQYDPNQYQPHENIRN 127 >ref|XP_003843655.1| hypothetical protein LEMA_P013060.1 [Leptosphaeria maculans JN3] gi|312220235|emb|CBY00176.1| hypothetical protein LEMA_P013060.1 [Leptosphaeria maculans JN3] Length = 130 Score = 62.0 bits (149), Expect = 2e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 352 KRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLE 242 KR A Q A+ +YD+HY+ +Q ADQYDPNQYGPPQ E Sbjct: 90 KRQARQNAEQMYDEHYINNQSADQYDPNQYGPPQHFE 126 >ref|XP_008080095.1| hypothetical protein GLAREA_06491 [Glarea lozoyensis ATCC 20868] gi|361125935|gb|EHK97954.1| hypothetical protein M7I_6295 [Glarea lozoyensis 74030] gi|512204655|gb|EPE33478.1| hypothetical protein GLAREA_06491 [Glarea lozoyensis ATCC 20868] Length = 128 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLE 242 +AKRHA +++YD+HYV+ QGADQYDPNQY PQ LE Sbjct: 88 KAKRHARDNVENMYDEHYVRGQGADQYDPNQYDRPQNLE 126 >gb|EUN29239.1| hypothetical protein COCVIDRAFT_93521 [Bipolaris victoriae FI3] Length = 1189 Score = 59.7 bits (143), Expect = 7e-07 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLEN 239 +AKR A+Q A+ +YD+HY+ + GADQYDPNQYG P+ L++ Sbjct: 90 KAKRDAKQHAERMYDEHYIDNHGADQYDPNQYGAPESLQS 129 >ref|XP_007714831.1| hypothetical protein COCCADRAFT_38960 [Bipolaris zeicola 26-R-13] gi|576916630|gb|EUC30882.1| hypothetical protein COCCADRAFT_38960 [Bipolaris zeicola 26-R-13] Length = 1187 Score = 59.7 bits (143), Expect = 7e-07 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLEN 239 +AKR A+Q A+ +YD+HY+ + GADQYDPNQYG P+ L++ Sbjct: 88 KAKRDAKQHAERMYDEHYIDNHGADQYDPNQYGAPESLQS 127 >gb|EMD92204.1| hypothetical protein COCHEDRAFT_1134453 [Bipolaris maydis C5] Length = 1137 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLE 242 +AK HA++ A+ +YD+HYV + GA++YDPNQYG P+R E Sbjct: 88 KAKHHAKENAERMYDEHYVDNHGANEYDPNQYGAPERFE 126 >ref|XP_003296736.1| hypothetical protein PTT_06916 [Pyrenophora teres f. teres 0-1] gi|311330974|gb|EFQ95159.1| hypothetical protein PTT_06916 [Pyrenophora teres f. teres 0-1] Length = 130 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -3 Query: 361 HEAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLEN 239 H+AK+HAEQ +YD HYV + GADQYDPNQY PQ+ +N Sbjct: 91 HDAKKHAEQ----MYDDHYVDNHGADQYDPNQYSRPQQFDN 127 >ref|XP_001941406.1| signal transduction protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977499|gb|EDU44125.1| signal transduction protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 130 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLEN 239 +AKR A++ A+ +YD HYV + GADQYDPNQY PQ+ +N Sbjct: 88 KAKRDAKKHAEQMYDDHYVDNHGADQYDPNQYSGPQQFDN 127 >gb|ENI07897.1| hypothetical protein COCC4DRAFT_162035 [Bipolaris maydis ATCC 48331] Length = 1186 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/40 (52%), Positives = 33/40 (82%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLEN 239 +AK HA++ A+ +YD+HYV + GA++YDPNQYG P+ L++ Sbjct: 88 KAKHHAKENAERMYDEHYVDNHGANEYDPNQYGAPESLQS 127 >ref|XP_007686474.1| hypothetical protein COCMIDRAFT_35404 [Bipolaris oryzae ATCC 44560] gi|576933437|gb|EUC46963.1| hypothetical protein COCMIDRAFT_35404 [Bipolaris oryzae ATCC 44560] Length = 1188 Score = 56.6 bits (135), Expect = 6e-06 Identities = 21/40 (52%), Positives = 33/40 (82%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLEN 239 +AKR A++ A+ +YD+HY+ + GADQY+PNQYG P+ L++ Sbjct: 88 KAKRDAKEHAERMYDEHYIDNHGADQYNPNQYGAPESLQS 127 >ref|XP_008028122.1| hypothetical protein SETTUDRAFT_33331 [Setosphaeria turcica Et28A] gi|482807290|gb|EOA84342.1| hypothetical protein SETTUDRAFT_33331 [Setosphaeria turcica Et28A] Length = 130 Score = 56.2 bits (134), Expect = 8e-06 Identities = 21/39 (53%), Positives = 31/39 (79%) Frame = -3 Query: 358 EAKRHAEQRAQDLYDQHYVQDQGADQYDPNQYGPPQRLE 242 +AK A+++A+ +YD+HY+ + GADQ+DPNQYG P R E Sbjct: 88 KAKHEAKKQAEQMYDEHYIDNHGADQFDPNQYGRPARFE 126