BLASTX nr result
ID: Cinnamomum23_contig00059221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00059221 (317 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003843508.1| hypothetical protein LEMA_P076180.1 [Leptosp... 61 3e-07 >ref|XP_003843508.1| hypothetical protein LEMA_P076180.1 [Leptosphaeria maculans JN3] gi|312220087|emb|CBY00029.1| hypothetical protein LEMA_P076180.1 [Leptosphaeria maculans JN3] Length = 282 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 96 MFGKRSFASSKDRSGKITKQPKRSFRETSKQK 1 MFGKRSFASSKDRSGKITK PKRSFRE +KQK Sbjct: 1 MFGKRSFASSKDRSGKITKAPKRSFREATKQK 32