BLASTX nr result
ID: Cinnamomum23_contig00059099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00059099 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM83257.1| hypothetical protein ANO11243_012430 [fungal sp.... 92 2e-16 gb|EMF08905.1| ribosomal protein S1 [Sphaerulina musiva SO2202] 81 2e-13 gb|KEQ93540.1| hypothetical protein AUEXF2481DRAFT_41779 [Aureob... 80 5e-13 gb|KEQ77355.1| ribosomal protein S1 [Aureobasidium namibiae CBS ... 80 5e-13 gb|KEQ67107.1| ribosomal protein S1 [Aureobasidium melanogenum C... 80 5e-13 ref|XP_007672514.1| hypothetical protein BAUCODRAFT_30455 [Baudo... 79 1e-12 gb|EME40292.1| hypothetical protein DOTSEDRAFT_74932 [Dothistrom... 78 3e-12 ref|XP_006692481.1| 40S ribosomal protein S20-like protein [Chae... 78 3e-12 gb|EKG10702.1| Ribosomal protein S10 [Macrophomina phaseolina MS6] 77 3e-12 gb|EFW17408.1| 40S ribosomal protein S20 [Coccidioides posadasii... 75 1e-11 gb|KKY31477.1| putative 40s ribosomal protein s20 [Diaporthe amp... 75 2e-11 ref|XP_003848554.1| 40S ribosomal protein S20 [Zymoseptoria trit... 75 2e-11 ref|XP_001228855.1| 40S ribosomal protein S20 [Chaetomium globos... 75 2e-11 ref|XP_003654779.1| 40S ribosomal protein S20 [Thielavia terrest... 75 2e-11 gb|KIV96375.1| 40S ribosomal protein S20 [Exophiala mesophila] 74 4e-11 ref|XP_007722178.1| 40S ribosomal protein S20 [Capronia coronata... 74 4e-11 gb|KIX00919.1| 40S ribosomal protein S20 [Rhinocladiella mackenz... 74 5e-11 gb|KFH45978.1| 40S ribosomal protein-like protein [Acremonium ch... 74 5e-11 ref|XP_007731365.1| 40S ribosomal protein S20 [Capronia epimyces... 73 8e-11 ref|XP_007742057.1| 40S ribosomal protein S20 [Cladophialophora ... 73 8e-11 >dbj|GAM83257.1| hypothetical protein ANO11243_012430 [fungal sp. No.11243] Length = 116 Score = 91.7 bits (226), Expect = 2e-16 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QD KKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR Sbjct: 1 MSFQDQKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 48 >gb|EMF08905.1| ribosomal protein S1 [Sphaerulina musiva SO2202] Length = 117 Score = 81.3 bits (199), Expect = 2e-13 Identities = 42/49 (85%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 146 MSYQDAKKS-QLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QDAKK LDAPKIHKIRITLTSRKVQSLEKVC+ELIERAK+K+LR Sbjct: 1 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCTELIERAKSKELR 49 >gb|KEQ93540.1| hypothetical protein AUEXF2481DRAFT_41779 [Aureobasidium subglaciale EXF-2481] Length = 117 Score = 80.1 bits (196), Expect = 5e-13 Identities = 41/49 (83%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 146 MSYQDAKKS-QLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QD KK+ Q DAPKIHKIRITLTSRKVQSLEKVC+ELI+RAK+KDLR Sbjct: 1 MSFQDPKKTGQADAPKIHKIRITLTSRKVQSLEKVCTELIDRAKSKDLR 49 >gb|KEQ77355.1| ribosomal protein S1 [Aureobasidium namibiae CBS 147.97] gi|662522759|gb|KEQ80157.1| ribosomal protein S1 [Aureobasidium pullulans EXF-150] Length = 117 Score = 80.1 bits (196), Expect = 5e-13 Identities = 41/49 (83%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 146 MSYQDAKKS-QLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QD KK+ Q DAPKIHKIRITLTSRKVQSLEKVC+ELI+RAK+KDLR Sbjct: 1 MSFQDPKKTGQADAPKIHKIRITLTSRKVQSLEKVCTELIDRAKSKDLR 49 >gb|KEQ67107.1| ribosomal protein S1 [Aureobasidium melanogenum CBS 110374] Length = 117 Score = 80.1 bits (196), Expect = 5e-13 Identities = 41/49 (83%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 146 MSYQDAKKS-QLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QD KK+ Q DAPKIHKIRITLTSRKVQSLEKVC+ELI+RAK+KDLR Sbjct: 1 MSFQDPKKTGQADAPKIHKIRITLTSRKVQSLEKVCTELIDRAKSKDLR 49 >ref|XP_007672514.1| hypothetical protein BAUCODRAFT_30455 [Baudoinia compniacensis UAMH 10762] gi|449304006|gb|EMD00014.1| hypothetical protein BAUCODRAFT_30455 [Baudoinia compniacensis UAMH 10762] Length = 117 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 MSYQDAKK-SQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QD KK SQ+D PKIHKIRITLTSRKV SLEKVCSELIERAK+K+LR Sbjct: 1 MSFQDPKKTSQIDQPKIHKIRITLTSRKVASLEKVCSELIERAKSKELR 49 >gb|EME40292.1| hypothetical protein DOTSEDRAFT_74932 [Dothistroma septosporum NZE10] Length = 117 Score = 77.8 bits (190), Expect = 3e-12 Identities = 40/49 (81%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 MSYQDAKK-SQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QD KK SQLDAPKIHKIRITLTSRKV +LEKVC ELI+RAK+K+LR Sbjct: 1 MSFQDPKKTSQLDAPKIHKIRITLTSRKVAALEKVCDELIQRAKSKELR 49 >ref|XP_006692481.1| 40S ribosomal protein S20-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340966955|gb|EGS22462.1| 40S ribosomal protein S20-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 116 Score = 77.8 bits (190), Expect = 3e-12 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MSYQ A+K +APK+HKIRITLTSRKVQSLEKVC ELIERAK KDLR Sbjct: 1 MSYQKAEKDFGEAPKVHKIRITLTSRKVQSLEKVCQELIERAKNKDLR 48 >gb|EKG10702.1| Ribosomal protein S10 [Macrophomina phaseolina MS6] Length = 135 Score = 77.4 bits (189), Expect = 3e-12 Identities = 41/66 (62%), Positives = 45/66 (68%), Gaps = 7/66 (10%) Frame = -1 Query: 179 PSPHLQPKTAAMSYQDAKKSQL-------DAPKIHKIRITLTSRKVQSLEKVCSELIERA 21 PSPH+ TA SY + K D PKIHKIRITLTSRKVQSLEKVC EL++RA Sbjct: 2 PSPHIVQSTANTSYSKSPKMSYNKEKDFGDGPKIHKIRITLTSRKVQSLEKVCQELLDRA 61 Query: 20 KTKDLR 3 K KDLR Sbjct: 62 KNKDLR 67 >gb|EFW17408.1| 40S ribosomal protein S20 [Coccidioides posadasii str. Silveira] Length = 130 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -1 Query: 164 QPKTAAMSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDL 6 QP+TA MSYQ +K + PKIHKIRITLTSRKV SLEKVC ELIERA++K L Sbjct: 9 QPQTAKMSYQKPEKDFGEGPKIHKIRITLTSRKVASLEKVCQELIERARSKSL 61 >gb|KKY31477.1| putative 40s ribosomal protein s20 [Diaporthe ampelina] Length = 123 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MSYQ +K + PK HKIRITLTSRKVQSLEKVC+ELIERAK KDLR Sbjct: 1 MSYQKPEKGDFEGPKTHKIRITLTSRKVQSLEKVCTELIERAKGKDLR 48 >ref|XP_003848554.1| 40S ribosomal protein S20 [Zymoseptoria tritici IPO323] gi|339468429|gb|EGP83530.1| hypothetical protein MYCGRDRAFT_88095 [Zymoseptoria tritici IPO323] gi|796691732|gb|KJX92176.1| 40s ribosomal protein s20 [Zymoseptoria brevis] Length = 117 Score = 75.1 bits (183), Expect = 2e-11 Identities = 39/49 (79%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -1 Query: 146 MSYQDAKKS-QLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+QDAKK Q DAPKIHKIRITLTS+KV +LEKVC ELIERAK+K+LR Sbjct: 1 MSFQDAKKGGQGDAPKIHKIRITLTSKKVTALEKVCGELIERAKSKELR 49 >ref|XP_001228855.1| 40S ribosomal protein S20 [Chaetomium globosum CBS 148.51] gi|88182936|gb|EAQ90404.1| hypothetical protein CHGG_02339 [Chaetomium globosum CBS 148.51] Length = 116 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MSY +K +APK+HKIRITLTSRKVQ+LEKVC ELIERAKTKDLR Sbjct: 1 MSYNKPEKEFGEAPKVHKIRITLTSRKVQALEKVCQELIERAKTKDLR 48 >ref|XP_003654779.1| 40S ribosomal protein S20 [Thielavia terrestris NRRL 8126] gi|347002042|gb|AEO68443.1| hypothetical protein THITE_2117985 [Thielavia terrestris NRRL 8126] Length = 116 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MSY +K +APK+HKIRITLTSRKVQSLEKVC ELIERAK KDLR Sbjct: 1 MSYNKPEKEYGEAPKVHKIRITLTSRKVQSLEKVCQELIERAKNKDLR 48 >gb|KIV96375.1| 40S ribosomal protein S20 [Exophiala mesophila] Length = 116 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+Q +K + PKIHKIRITLTSRKVQSLEKVCSEL+ERAKTK+LR Sbjct: 1 MSFQKPEKDFGEGPKIHKIRITLTSRKVQSLEKVCSELLERAKTKNLR 48 >ref|XP_007722178.1| 40S ribosomal protein S20 [Capronia coronata CBS 617.96] gi|590019485|gb|EXJ94684.1| 40S ribosomal protein S20 [Capronia coronata CBS 617.96] Length = 116 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MSYQ +K + PKIHKIRITLTSRKVQSLEKVCSEL+ERAK+K+LR Sbjct: 1 MSYQKPEKDFGEGPKIHKIRITLTSRKVQSLEKVCSELLERAKSKNLR 48 >gb|KIX00919.1| 40S ribosomal protein S20 [Rhinocladiella mackenziei CBS 650.93] Length = 116 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+Q +K + PKIHKIRITLTSRKVQSLEKVCSEL+ERAK+K+LR Sbjct: 1 MSFQKPEKDFAEGPKIHKIRITLTSRKVQSLEKVCSELLERAKSKNLR 48 >gb|KFH45978.1| 40S ribosomal protein-like protein [Acremonium chrysogenum ATCC 11550] Length = 117 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -1 Query: 143 SYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 SYQ +K Q DAPK HKIRITLTSRKVQ LEKVC+E++ERAK+KDLR Sbjct: 3 SYQKPEKDQGDAPKSHKIRITLTSRKVQILEKVCTEILERAKSKDLR 49 >ref|XP_007731365.1| 40S ribosomal protein S20 [Capronia epimyces CBS 606.96] gi|590014766|gb|EXJ89968.1| 40S ribosomal protein S20 [Capronia epimyces CBS 606.96] Length = 116 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MSYQ +K + PKIHKIRITLTSRKVQ+LEKVCSEL+ERAK+K+LR Sbjct: 1 MSYQKPEKDFGEGPKIHKIRITLTSRKVQALEKVCSELLERAKSKNLR 48 >ref|XP_007742057.1| 40S ribosomal protein S20 [Cladophialophora psammophila CBS 110553] gi|589990844|gb|EXJ73494.1| 40S ribosomal protein S20 [Cladophialophora psammophila CBS 110553] gi|759312893|gb|KIW89251.1| 40S ribosomal protein S20 [Cladophialophora bantiana CBS 173.52] gi|761342083|gb|KIY02974.1| 40S ribosomal protein S20 [Fonsecaea multimorphosa CBS 102226] Length = 116 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -1 Query: 146 MSYQDAKKSQLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLR 3 MS+Q +K + PKIHKIRITLTSRKVQSLEKVCSEL++RAKTK+LR Sbjct: 1 MSFQKPEKDFGEGPKIHKIRITLTSRKVQSLEKVCSELLDRAKTKNLR 48