BLASTX nr result
ID: Cinnamomum23_contig00059006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00059006 (295 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007926613.1| hypothetical protein MYCFIDRAFT_211317 [Pseu... 58 3e-06 >ref|XP_007926613.1| hypothetical protein MYCFIDRAFT_211317 [Pseudocercospora fijiensis CIRAD86] gi|452983615|gb|EME83373.1| hypothetical protein MYCFIDRAFT_211317 [Pseudocercospora fijiensis CIRAD86] Length = 422 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 7/103 (6%) Frame = -2 Query: 288 MSAGHISLVRHLAKRSDDW-------VSVPRSNFPAFKTQGGRHNGNGPDIQIKGYEAAI 130 MS H ++ HLA+R D V V + + GP ++IK YE Sbjct: 1 MSGVHGHVIGHLARRGYDAAQAYFHEVRVSAEQMAQLQQDAELYEQAGPAMEIKPYEMLP 60 Query: 129 VLISVVVMVLAYASLKYTIGNIMAALASIEQPRTAVVLETPNP 1 VLI+ + +L AS+KYT+G ++A+LA IE P + ++E P Sbjct: 61 VLITAFLTILLVASIKYTLGEVVASLAMIESPTSTAIIEDKPP 103