BLASTX nr result
ID: Cinnamomum23_contig00058921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00058921 (358 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001595179.1| hypothetical protein SS1G_03268 [Sclerotinia... 67 5e-09 emb|CCD53999.1| CND17 [Botrytis cinerea T4] gi|472243508|gb|EMR8... 66 8e-09 ref|XP_001554672.1| hypothetical protein BC1G_06815 [Botrytis ci... 66 8e-09 gb|KKA28952.1| hypothetical protein TD95_000918 [Thielaviopsis p... 65 2e-08 gb|KKY39243.1| putative adhesin protein mad1 [Diaporthe ampelina] 62 2e-07 gb|ESZ94550.1| hypothetical protein SBOR_5040 [Sclerotinia borea... 60 4e-07 ref|XP_009161165.1| hypothetical protein HMPREF1120_08653 [Exoph... 60 7e-07 ref|XP_007278022.1| extracellular serine-threonine rich protein ... 59 2e-06 ref|XP_007915653.1| putative adhesin protein mad1 protein [Togni... 58 2e-06 ref|XP_008090850.1| adhesin protein Mad1 [Colletotrichum gramini... 57 5e-06 >ref|XP_001595179.1| hypothetical protein SS1G_03268 [Sclerotinia sclerotiorum 1980] gi|154701055|gb|EDO00794.1| hypothetical protein SS1G_03268 [Sclerotinia sclerotiorum 1980 UF-70] Length = 1041 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -2 Query: 135 DSGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 D SF+CP+NTNN+C +QK GWDFGDL G S Y+ SFSGF+ Sbjct: 26 DKSSFSCPSNTNNECSSTQKSGWDFGDLTSGSFSFYDDFSFSGFT 70 >emb|CCD53999.1| CND17 [Botrytis cinerea T4] gi|472243508|gb|EMR88161.1| putative adhesin protein mad1 protein [Botrytis cinerea BcDW1] Length = 938 Score = 66.2 bits (160), Expect = 8e-09 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 135 DSGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 D SF+CP+NTNN+C +QK GWDF DL G S+Y+ SFSGF+ Sbjct: 26 DKSSFSCPSNTNNECSSTQKSGWDFSDLTSGSFSNYDAFSFSGFT 70 >ref|XP_001554672.1| hypothetical protein BC1G_06815 [Botrytis cinerea B05.10] Length = 933 Score = 66.2 bits (160), Expect = 8e-09 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 135 DSGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 D SF+CP+NTNN+C +QK GWDF DL G S+Y+ SFSGF+ Sbjct: 26 DKSSFSCPSNTNNECSSTQKSGWDFSDLTSGSFSNYDAFSFSGFT 70 >gb|KKA28952.1| hypothetical protein TD95_000918 [Thielaviopsis punctulata] Length = 788 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 132 SGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 +G F+CP NTNNQC D+QK G+ +GDLP G S YNG FSG+S Sbjct: 24 TGKFSCPDNTNNQCTDAQKSGFSWGDLPTGSFSMYNGFQFSGWS 67 >gb|KKY39243.1| putative adhesin protein mad1 [Diaporthe ampelina] Length = 682 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = -2 Query: 135 DSGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGF 4 D G FNCP NT+N+C+ Q+ GWD+ DL G SSY G SF GF Sbjct: 20 DFGGFNCPDNTDNKCNTQQQSGWDWSDLATGDFSSYGGFSFGGF 63 >gb|ESZ94550.1| hypothetical protein SBOR_5040 [Sclerotinia borealis F-4157] Length = 890 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = -2 Query: 135 DSGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 D SF+CP+NTNN C +Q GWDF DL G S+Y+ +F+GF+ Sbjct: 26 DKSSFSCPSNTNNDCSSTQHSGWDFSDLSSGSFSNYDDFTFTGFT 70 >ref|XP_009161165.1| hypothetical protein HMPREF1120_08653 [Exophiala dermatitidis NIH/UT8656] gi|378734245|gb|EHY60704.1| hypothetical protein HMPREF1120_08653 [Exophiala dermatitidis NIH/UT8656] Length = 701 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 135 DSGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 D+ SF CPANTNN C SQ++G+D+ DL G +SY G SFSGF+ Sbjct: 26 DAPSFPCPANTNNTCSSSQQRGFDWSDLQIGGFNSYGGFSFSGFT 70 >ref|XP_007278022.1| extracellular serine-threonine rich protein [Colletotrichum gloeosporioides Nara gc5] gi|429858130|gb|ELA32961.1| extracellular serine-threonine rich protein [Colletotrichum gloeosporioides Nara gc5] Length = 669 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -2 Query: 126 SFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 SF+CP NTNN+CDD QK G+ +GDL G SSY G F G++ Sbjct: 26 SFDCPDNTNNECDDKQKSGFSWGDLNTGSFSSYGGFDFKGWT 67 >ref|XP_007915653.1| putative adhesin protein mad1 protein [Togninia minima UCRPA7] gi|500256326|gb|EON99597.1| putative adhesin protein mad1 protein [Togninia minima UCRPA7] Length = 602 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = -2 Query: 135 DSGSFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 D GSF+CP+NT+NQC D Q+ G+ + DLP G S+Y G +F G++ Sbjct: 22 DYGSFSCPSNTDNQCTDKQRGGFSWDDLPTGSFSNYGGFNFKGWT 66 >ref|XP_008090850.1| adhesin protein Mad1 [Colletotrichum graminicola M1.001] gi|310791301|gb|EFQ26830.1| adhesin protein Mad1 [Colletotrichum graminicola M1.001] Length = 657 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = -2 Query: 126 SFNCPANTNNQCDDSQKKGWDFGDLPKGPVSSYNGHSFSGFS 1 SF CP NT+NQCDD QK G+ +GDL G S+Y G F G++ Sbjct: 27 SFTCPQNTDNQCDDKQKSGFSWGDLSTGSFSNYGGFDFKGWT 68