BLASTX nr result
ID: Cinnamomum23_contig00058726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00058726 (259 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66188.1| hypothetical protein [Beta vulgaris subsp. vulga... 57 4e-06 emb|CAN71644.1| hypothetical protein VITISV_041775 [Vitis vinifera] 57 6e-06 >emb|CCA66188.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1381 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/87 (41%), Positives = 43/87 (49%), Gaps = 1/87 (1%) Frame = +1 Query: 1 GVGPLFLSFPRLFGVVINKWASIQDYCVGW-GRVGSWNVSFRRALRLSEESKYESLVNLL 177 G PL L FPRLF +V N A I C W GR WN S+ R R + ++E L LL Sbjct: 945 GDSPLKLRFPRLFTIVDNPMAYIAS-CGSWCGREWVWNFSWSRVFRPRDAEEWEELQGLL 1003 Query: 178 SNVFICTDATDYRIWKPTTSSKFSGKS 258 +V + D IW P S FS KS Sbjct: 1004 GSVCLSPSTDDRLIWTPHKSGAFSVKS 1030 >emb|CAN71644.1| hypothetical protein VITISV_041775 [Vitis vinifera] Length = 392 Score = 56.6 bits (135), Expect = 6e-06 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = +1 Query: 1 GVGPLFLSFPRLFGVVINKWASIQDYCVGWGRVGSWNVSFRRALRLSEESKYESLVNLLS 180 G PL +PRLF VV++K SI +G R SWN++FRR L SE E L+ L Sbjct: 119 GDQPLGTQYPRLFRVVVDKNISISSV-LGPSRPFSWNLNFRRNLSDSEIEDLEGLMRSLD 177 Query: 181 NVFICTDATDYRIWKPTTSSKFSGKS 258 ++++ D R+W ++S FS KS Sbjct: 178 DLYLSPSVPDARLWPLSSSGLFSVKS 203