BLASTX nr result
ID: Cinnamomum23_contig00058159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00058159 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUN29575.1| hypothetical protein COCVIDRAFT_72391, partial [B... 57 4e-06 ref|XP_007710010.1| hypothetical protein COCCADRAFT_66389, parti... 57 4e-06 >gb|EUN29575.1| hypothetical protein COCVIDRAFT_72391, partial [Bipolaris victoriae FI3] Length = 299 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/69 (39%), Positives = 42/69 (60%) Frame = -3 Query: 317 NYVLITKENAAQWQCGGYQELNELLKLFRDKEEGGMKLIHNIFLNPYRLENYILHGTNGA 138 N++LIT++N A W Y L LL+ + KE GM+ + N+ L+P+R ++LH NG Sbjct: 146 NFILITEKNTAVWDLPCYPHLRSLLEE-KKKEGSGMREVQNVTLHPHRYACFLLHFKNGK 204 Query: 137 VCMNNLPPH 111 + N+PPH Sbjct: 205 LEFGNVPPH 213 >ref|XP_007710010.1| hypothetical protein COCCADRAFT_66389, partial [Bipolaris zeicola 26-R-13] gi|576921561|gb|EUC35700.1| hypothetical protein COCCADRAFT_66389, partial [Bipolaris zeicola 26-R-13] Length = 294 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/69 (39%), Positives = 42/69 (60%) Frame = -3 Query: 317 NYVLITKENAAQWQCGGYQELNELLKLFRDKEEGGMKLIHNIFLNPYRLENYILHGTNGA 138 N++LIT++N A W Y L LL+ + KE GM+ + N+ L+P+R ++LH NG Sbjct: 146 NFILITEKNTAVWDLPCYPHLRSLLEE-KKKEGSGMREVQNVTLHPHRYACFLLHFKNGK 204 Query: 137 VCMNNLPPH 111 + N+PPH Sbjct: 205 LEFGNVPPH 213