BLASTX nr result
ID: Cinnamomum23_contig00058156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00058156 (375 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ83392.1| hypothetical protein M438DRAFT_406351 [Aureobasid... 59 2e-06 gb|KEQ69736.1| hypothetical protein M436DRAFT_55419 [Aureobasidi... 57 4e-06 >gb|KEQ83392.1| hypothetical protein M438DRAFT_406351 [Aureobasidium pullulans EXF-150] Length = 251 Score = 58.5 bits (140), Expect = 2e-06 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = -1 Query: 213 DQRHELESRAVGLLLYLSFPVALVSTLIAGWTAICLVLFLLAQPLRFLH-SRPSPSSELN 37 DQR LES+A+ +LLYLS P L+S L+ W+ + + +L PLRF SR S S EL Sbjct: 100 DQRLHLESKAIKILLYLSGPCVLLSGLLCIWSLVVTLFTVLTYPLRFFSASRRSLSEELR 159 Query: 36 YIISPSLRLQLR 1 +++ S RLQLR Sbjct: 160 SLLARSNRLQLR 171 >gb|KEQ69736.1| hypothetical protein M436DRAFT_55419 [Aureobasidium namibiae CBS 147.97] Length = 252 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = -1 Query: 213 DQRHELESRAVGLLLYLSFPVALVSTLIAGWTAICLVLFLLAQPLRFLHSRPSP-SSELN 37 DQR LES+A+ +LLYLS P LVS L+ W+ + +L PLR L + P S EL Sbjct: 101 DQRLHLESKAIKILLYLSGPCVLVSFLLCVWSLVITFFTVLTYPLRLLSASRQPLSDELR 160 Query: 36 YIISPSLRLQLR 1 +++ S RLQLR Sbjct: 161 SLLARSNRLQLR 172