BLASTX nr result
ID: Cinnamomum23_contig00057971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057971 (288 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN12701.1| Tubby-like F-box protein 5 [Glycine soja] 57 6e-06 ref|XP_006601317.1| PREDICTED: tubby-like F-box protein 5-like i... 57 6e-06 ref|XP_006601316.1| PREDICTED: tubby-like F-box protein 5-like i... 57 6e-06 ref|XP_003550385.1| PREDICTED: tubby-like F-box protein 5-like i... 57 6e-06 >gb|KHN12701.1| Tubby-like F-box protein 5 [Glycine soja] Length = 436 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 208 AAKWIRRATVTEFVISLSADDFFWANNKYVGKLRYDF 98 AAK IRRAT TEF+ISL +DDF WA+N YVGKLR +F Sbjct: 168 AAKKIRRATCTEFIISLVSDDFSWASNTYVGKLRSNF 204 >ref|XP_006601317.1| PREDICTED: tubby-like F-box protein 5-like isoform X3 [Glycine max] Length = 448 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 208 AAKWIRRATVTEFVISLSADDFFWANNKYVGKLRYDF 98 AAK IRRAT TEF+ISL +DDF WA+N YVGKLR +F Sbjct: 180 AAKKIRRATCTEFIISLVSDDFSWASNTYVGKLRSNF 216 >ref|XP_006601316.1| PREDICTED: tubby-like F-box protein 5-like isoform X2 [Glycine max] Length = 454 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 208 AAKWIRRATVTEFVISLSADDFFWANNKYVGKLRYDF 98 AAK IRRAT TEF+ISL +DDF WA+N YVGKLR +F Sbjct: 186 AAKKIRRATCTEFIISLVSDDFSWASNTYVGKLRSNF 222 >ref|XP_003550385.1| PREDICTED: tubby-like F-box protein 5-like isoform X1 [Glycine max] Length = 436 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 208 AAKWIRRATVTEFVISLSADDFFWANNKYVGKLRYDF 98 AAK IRRAT TEF+ISL +DDF WA+N YVGKLR +F Sbjct: 168 AAKKIRRATCTEFIISLVSDDFSWASNTYVGKLRSNF 204