BLASTX nr result
ID: Cinnamomum23_contig00057766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057766 (681 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23724.3| unnamed protein product [Vitis vinifera] 58 4e-06 ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13 [V... 58 4e-06 >emb|CBI23724.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 58.2 bits (139), Expect = 4e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 96 MFLSTVKRLRIMRTSEANGLAPRLQHKSDRQR 1 MFLSTVKRLRIMRTSEANGLAPR Q +S+RQR Sbjct: 248 MFLSTVKRLRIMRTSEANGLAPRFQERSERQR 279 >ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13 [Vitis vinifera] Length = 321 Score = 58.2 bits (139), Expect = 4e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 96 MFLSTVKRLRIMRTSEANGLAPRLQHKSDRQR 1 MFLSTVKRLRIMRTSEANGLAPR Q +S+RQR Sbjct: 286 MFLSTVKRLRIMRTSEANGLAPRFQERSERQR 317