BLASTX nr result
ID: Cinnamomum23_contig00057756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057756 (277 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containi... 176 5e-42 ref|XP_007159381.1| hypothetical protein PHAVU_002G233400g [Phas... 169 7e-40 ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containi... 166 4e-39 ref|XP_003547194.1| PREDICTED: pentatricopeptide repeat-containi... 166 4e-39 ref|XP_008775491.1| PREDICTED: pentatricopeptide repeat-containi... 164 3e-38 ref|XP_010940775.1| PREDICTED: pentatricopeptide repeat-containi... 160 3e-37 ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containi... 160 4e-37 ref|XP_003593855.1| Pentatricopeptide repeat-containing protein ... 160 4e-37 ref|XP_003541675.1| PREDICTED: pentatricopeptide repeat-containi... 158 1e-36 ref|XP_006836351.1| PREDICTED: pentatricopeptide repeat-containi... 158 2e-36 emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] 158 2e-36 ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containi... 157 2e-36 ref|XP_007024973.1| Tetratricopeptide repeat-like superfamily pr... 157 2e-36 ref|XP_007024972.1| Tetratricopeptide repeat (TPR)-like superfam... 157 2e-36 ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containi... 156 4e-36 gb|KJB69879.1| hypothetical protein B456_011G048000 [Gossypium r... 156 4e-36 ref|XP_008225527.1| PREDICTED: pentatricopeptide repeat-containi... 155 1e-35 ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, part... 154 2e-35 ref|XP_009399026.1| PREDICTED: pentatricopeptide repeat-containi... 154 3e-35 ref|XP_008439592.1| PREDICTED: pentatricopeptide repeat-containi... 152 6e-35 >ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061056|ref|XP_010275051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061060|ref|XP_010275052.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061063|ref|XP_010275053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] Length = 824 Score = 176 bits (446), Expect = 5e-42 Identities = 84/92 (91%), Positives = 86/92 (93%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 NFFYWADRQWRYRH EVYY MLEVLSKTKLCQGA+R+LRLM RRGIE RPEAFGYVMVS Sbjct: 213 NFFYWADRQWRYRHDTEVYYAMLEVLSKTKLCQGAKRILRLMARRGIERRPEAFGYVMVS 272 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 YSRAGKLRSAMRVLNLMQKAGCEPD SICNTA Sbjct: 273 YSRAGKLRSAMRVLNLMQKAGCEPDSSICNTA 304 >ref|XP_007159381.1| hypothetical protein PHAVU_002G233400g [Phaseolus vulgaris] gi|561032796|gb|ESW31375.1| hypothetical protein PHAVU_002G233400g [Phaseolus vulgaris] Length = 785 Score = 169 bits (428), Expect = 7e-40 Identities = 80/91 (87%), Positives = 85/91 (93%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 N+FYWADRQWRYRH VYYTML+VLS+TKLCQGARRVLRLMTRRGIEC PEAFGYVMVS Sbjct: 177 NYFYWADRQWRYRHDPVVYYTMLDVLSRTKLCQGARRVLRLMTRRGIECSPEAFGYVMVS 236 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNT 4 YSRAGKLR+A+RVL LMQKAG EPDLSICNT Sbjct: 237 YSRAGKLRNALRVLTLMQKAGVEPDLSICNT 267 >ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial [Cicer arietinum] Length = 784 Score = 166 bits (421), Expect = 4e-39 Identities = 77/91 (84%), Positives = 85/91 (93%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 +FFYWADRQWRYRH VYYTML++LSKTKLCQGARR+LRLMTRRGIEC PEAFGYVMVS Sbjct: 172 SFFYWADRQWRYRHDTIVYYTMLDILSKTKLCQGARRILRLMTRRGIECTPEAFGYVMVS 231 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNT 4 YSRAGKLR+A+++L LMQKAG EPDLSICNT Sbjct: 232 YSRAGKLRNALQLLTLMQKAGVEPDLSICNT 262 >ref|XP_003547194.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Glycine max] gi|734331133|gb|KHN06945.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 793 Score = 166 bits (421), Expect = 4e-39 Identities = 80/91 (87%), Positives = 83/91 (91%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 NFFYWADRQWRY H VYYTML+VLSKTKLCQGARRVLRLMTRRGIEC PEAFGYVMVS Sbjct: 185 NFFYWADRQWRYSHHPVVYYTMLDVLSKTKLCQGARRVLRLMTRRGIECPPEAFGYVMVS 244 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNT 4 YSRAGKLR+A+RVL LMQKAG EP LSICNT Sbjct: 245 YSRAGKLRNALRVLTLMQKAGVEPSLSICNT 275 >ref|XP_008775491.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Phoenix dactylifera] gi|672191369|ref|XP_008775492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Phoenix dactylifera] Length = 851 Score = 164 bits (414), Expect = 3e-38 Identities = 77/92 (83%), Positives = 83/92 (90%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 +FFYWADRQWRYRH EVYYTMLE+LSKTKLCQ +RR+LRLM RRGI +PEAF Y+MVS Sbjct: 241 SFFYWADRQWRYRHTPEVYYTMLEILSKTKLCQASRRILRLMIRRGISRQPEAFAYLMVS 300 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 YSRAGKLRSAMRVLNLMQK GC PDLSICNTA Sbjct: 301 YSRAGKLRSAMRVLNLMQKDGCGPDLSICNTA 332 >ref|XP_010940775.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761143|ref|XP_010940780.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761145|ref|XP_010940785.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761147|ref|XP_010940792.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761149|ref|XP_010940799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] gi|743761151|ref|XP_010940808.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Elaeis guineensis] Length = 869 Score = 160 bits (405), Expect = 3e-37 Identities = 76/92 (82%), Positives = 82/92 (89%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 +FF WADRQWRYRH EVYYTMLE+LSKTKLCQ +RR+LRLM RRGI +PEAF Y+MVS Sbjct: 258 SFFSWADRQWRYRHAPEVYYTMLEILSKTKLCQASRRILRLMIRRGISRQPEAFAYLMVS 317 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 YSRAGKLRSAMRVLNLMQK GC PDLSICNTA Sbjct: 318 YSRAGKLRSAMRVLNLMQKDGCGPDLSICNTA 349 >ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Vitis vinifera] Length = 827 Score = 160 bits (404), Expect = 4e-37 Identities = 77/91 (84%), Positives = 82/91 (90%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRYRH VYY MLE+LSKTKLCQGA+RVLRLM +R IE RPEAFGYVMVSY Sbjct: 214 FFYWADRQWRYRHDPIVYYAMLEILSKTKLCQGAKRVLRLMAKRRIERRPEAFGYVMVSY 273 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAGKLR+AMRVL +MQKAG EPDLSICNTA Sbjct: 274 SRAGKLRNAMRVLTMMQKAGIEPDLSICNTA 304 >ref|XP_003593855.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355482903|gb|AES64106.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 790 Score = 160 bits (404), Expect = 4e-37 Identities = 75/92 (81%), Positives = 83/92 (90%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 +FFYWADRQWRYRH VYYTML++LSKT+LCQGARR+LRLMTRRGIE PEAF YVMVS Sbjct: 182 DFFYWADRQWRYRHDAIVYYTMLDILSKTRLCQGARRILRLMTRRGIERSPEAFSYVMVS 241 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 YSRAG LR+A+R+L LMQKAG EPDLSICNTA Sbjct: 242 YSRAGMLRNALRILTLMQKAGVEPDLSICNTA 273 >ref|XP_003541675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Glycine max] Length = 789 Score = 158 bits (400), Expect = 1e-36 Identities = 77/91 (84%), Positives = 82/91 (90%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 NFFYWADRQWRY H VYYT+L+VLSKTKLCQGARRVLRLMTRRGIE PEAFG VMVS Sbjct: 181 NFFYWADRQWRYSHHPLVYYTLLDVLSKTKLCQGARRVLRLMTRRGIELSPEAFGCVMVS 240 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNT 4 YSRAGKLR+A+RVL LMQKAG EP+LSICNT Sbjct: 241 YSRAGKLRNALRVLTLMQKAGVEPNLSICNT 271 >ref|XP_006836351.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Amborella trichopoda] gi|548838869|gb|ERM99204.1| hypothetical protein AMTR_s00092p00105940 [Amborella trichopoda] Length = 829 Score = 158 bits (399), Expect = 2e-36 Identities = 74/92 (80%), Positives = 84/92 (91%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 +FFYWADRQWRYRH +EVYYTMLE+LSKTKLCQG+RR+LRLM RRGI+ R + FG VMVS Sbjct: 218 SFFYWADRQWRYRHGIEVYYTMLEILSKTKLCQGSRRILRLMERRGIQRRTQDFGNVMVS 277 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 YSRAGKLRSAMRVLNL+QK+G PD+SICNTA Sbjct: 278 YSRAGKLRSAMRVLNLLQKSGLGPDISICNTA 309 >emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] Length = 733 Score = 158 bits (399), Expect = 2e-36 Identities = 76/91 (83%), Positives = 81/91 (89%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRYRH VYY MLE+LSKTKLCQGA+RVLRLM +R IE RPEAFGYVMVSY Sbjct: 120 FFYWADRQWRYRHDPIVYYAMLEILSKTKLCQGAKRVLRLMAKRRIERRPEAFGYVMVSY 179 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAGKLR+AMR L +MQKAG EPDLSICNTA Sbjct: 180 SRAGKLRNAMRXLTMMQKAGIEPDLSICNTA 210 >ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795643|ref|XP_012092558.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795647|ref|XP_012092559.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|643702015|gb|KDP20455.1| hypothetical protein JCGZ_05300 [Jatropha curcas] Length = 833 Score = 157 bits (398), Expect = 2e-36 Identities = 76/92 (82%), Positives = 81/92 (88%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 NFFYWADRQWRYRH VYY MLEVLSKTKLCQGARR+LRLM RRGI CR EAF YVMVS Sbjct: 217 NFFYWADRQWRYRHDPIVYYVMLEVLSKTKLCQGARRILRLMARRGIYCRHEAFAYVMVS 276 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 YSRAGKLR+AM+VL +MQKAG EP+L ICNTA Sbjct: 277 YSRAGKLRNAMQVLTVMQKAGVEPNLLICNTA 308 >ref|XP_007024973.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|590622167|ref|XP_007024974.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|590622170|ref|XP_007024975.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508780339|gb|EOY27595.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508780340|gb|EOY27596.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508780341|gb|EOY27597.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 848 Score = 157 bits (398), Expect = 2e-36 Identities = 74/91 (81%), Positives = 82/91 (90%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRYRH + VYY MLE+LSKTKLCQGA+RVLRLM RRGIEC+PEAF Y+MVSY Sbjct: 238 FFYWADRQWRYRHNLIVYYIMLEILSKTKLCQGAKRVLRLMARRGIECQPEAFSYLMVSY 297 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAGKLR AM+VL LMQKAG E +LS+CNTA Sbjct: 298 SRAGKLRDAMKVLTLMQKAGVELNLSVCNTA 328 >ref|XP_007024972.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508780338|gb|EOY27594.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 761 Score = 157 bits (398), Expect = 2e-36 Identities = 74/91 (81%), Positives = 82/91 (90%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRYRH + VYY MLE+LSKTKLCQGA+RVLRLM RRGIEC+PEAF Y+MVSY Sbjct: 151 FFYWADRQWRYRHNLIVYYIMLEILSKTKLCQGAKRVLRLMARRGIECQPEAFSYLMVSY 210 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAGKLR AM+VL LMQKAG E +LS+CNTA Sbjct: 211 SRAGKLRDAMKVLTLMQKAGVELNLSVCNTA 241 >ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242162|ref|XP_012453779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242164|ref|XP_012453780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242166|ref|XP_012453781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242168|ref|XP_012453782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242170|ref|XP_012453783.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242172|ref|XP_012453784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] Length = 807 Score = 156 bits (395), Expect = 4e-36 Identities = 73/91 (80%), Positives = 82/91 (90%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRYRH VYY MLE+LSKTKLCQGA+RVLRL+ RRGIECRPEAFGY+MVSY Sbjct: 197 FFYWADRQWRYRHNPIVYYAMLEILSKTKLCQGAKRVLRLIARRGIECRPEAFGYLMVSY 256 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAG LR+AM+VL LMQKAG E +L++CNTA Sbjct: 257 SRAGNLRNAMKVLTLMQKAGVELNLAVCNTA 287 >gb|KJB69879.1| hypothetical protein B456_011G048000 [Gossypium raimondii] gi|763802942|gb|KJB69880.1| hypothetical protein B456_011G048000 [Gossypium raimondii] gi|763802943|gb|KJB69881.1| hypothetical protein B456_011G048000 [Gossypium raimondii] gi|763802944|gb|KJB69882.1| hypothetical protein B456_011G048000 [Gossypium raimondii] Length = 737 Score = 156 bits (395), Expect = 4e-36 Identities = 73/91 (80%), Positives = 82/91 (90%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRYRH VYY MLE+LSKTKLCQGA+RVLRL+ RRGIECRPEAFGY+MVSY Sbjct: 127 FFYWADRQWRYRHNPIVYYAMLEILSKTKLCQGAKRVLRLIARRGIECRPEAFGYLMVSY 186 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAG LR+AM+VL LMQKAG E +L++CNTA Sbjct: 187 SRAGNLRNAMKVLTLMQKAGVELNLAVCNTA 217 >ref|XP_008225527.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Prunus mume] Length = 823 Score = 155 bits (391), Expect = 1e-35 Identities = 75/91 (82%), Positives = 80/91 (87%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRY+H VYY MLEVLSKTKLCQGA+RVLRLM RRGIE PEAFGYVMVSY Sbjct: 208 FFYWADRQWRYKHYPVVYYAMLEVLSKTKLCQGAKRVLRLMARRGIERSPEAFGYVMVSY 267 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAGKLR AMRVL LMQKAG E ++S+CNTA Sbjct: 268 SRAGKLRHAMRVLTLMQKAGVELNVSVCNTA 298 >ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] gi|462410561|gb|EMJ15895.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] Length = 802 Score = 154 bits (389), Expect = 2e-35 Identities = 75/91 (82%), Positives = 80/91 (87%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADRQWRY+H VYY ML+VLSKTKLCQGA+RVLRLM RRGIE PEAFGYVMVSY Sbjct: 187 FFYWADRQWRYKHYPVVYYAMLDVLSKTKLCQGAKRVLRLMARRGIERSPEAFGYVMVSY 246 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAGKLR AMRVL LMQKAG E ++SICNTA Sbjct: 247 SRAGKLRHAMRVLTLMQKAGVELNVSICNTA 277 >ref|XP_009399026.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Musa acuminata subsp. malaccensis] gi|695023683|ref|XP_009399027.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Musa acuminata subsp. malaccensis] gi|695023685|ref|XP_009399028.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Musa acuminata subsp. malaccensis] gi|695023687|ref|XP_009399029.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Musa acuminata subsp. malaccensis] Length = 829 Score = 154 bits (388), Expect = 3e-35 Identities = 73/91 (80%), Positives = 78/91 (85%) Frame = -2 Query: 276 NFFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVS 97 NFFYWADRQWRYRH EVYYTMLE+LSKTKLCQ +RR LRLM RR I RP+ F ++MVS Sbjct: 218 NFFYWADRQWRYRHAPEVYYTMLELLSKTKLCQASRRALRLMIRRRISRRPQDFAHLMVS 277 Query: 96 YSRAGKLRSAMRVLNLMQKAGCEPDLSICNT 4 YSRAGKLRSAMRVLNLMQK GC PDL ICNT Sbjct: 278 YSRAGKLRSAMRVLNLMQKDGCAPDLCICNT 308 >ref|XP_008439592.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Cucumis melo] Length = 847 Score = 152 bits (385), Expect = 6e-35 Identities = 73/91 (80%), Positives = 80/91 (87%) Frame = -2 Query: 273 FFYWADRQWRYRHVVEVYYTMLEVLSKTKLCQGARRVLRLMTRRGIECRPEAFGYVMVSY 94 FFYWADR WRYRH VY MLE+LSKTKLCQGA+RVLRLMTRRGI+ PEAFG+VMVSY Sbjct: 232 FFYWADRLWRYRHDSSVYLVMLEILSKTKLCQGAKRVLRLMTRRGIQLCPEAFGFVMVSY 291 Query: 93 SRAGKLRSAMRVLNLMQKAGCEPDLSICNTA 1 SRAG+LR AM+VL LMQKAG EP+LSICNTA Sbjct: 292 SRAGRLRDAMKVLTLMQKAGVEPNLSICNTA 322