BLASTX nr result
ID: Cinnamomum23_contig00057272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057272 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010248390.1| PREDICTED: transcription repressor OFP5-like... 60 6e-07 ref|XP_002305721.2| ovate family protein [Populus trichocarpa] g... 60 6e-07 ref|XP_010916741.1| PREDICTED: transcription repressor OFP7-like... 60 7e-07 ref|XP_011010911.1| PREDICTED: transcription repressor OFP5-like... 59 1e-06 ref|XP_011033512.1| PREDICTED: transcription repressor OFP5-like... 59 1e-06 ref|XP_012091839.1| PREDICTED: transcription repressor OFP5 [Jat... 59 1e-06 ref|XP_009406773.1| PREDICTED: transcription repressor OFP1-like... 59 2e-06 ref|XP_008790074.1| PREDICTED: transcription repressor OFP3-like... 58 2e-06 ref|XP_010925176.1| PREDICTED: transcription repressor OFP5-like... 58 3e-06 ref|XP_010917398.1| PREDICTED: transcription repressor OFP5-like... 58 3e-06 ref|XP_010242153.1| PREDICTED: transcription repressor OFP3-like... 58 3e-06 ref|XP_008777736.1| PREDICTED: transcription repressor OFP5-like... 58 3e-06 ref|XP_008792401.1| PREDICTED: transcription repressor OFP5-like... 58 3e-06 ref|XP_007213877.1| hypothetical protein PRUPE_ppa006822mg [Prun... 57 4e-06 ref|XP_011658258.1| PREDICTED: transcription repressor OFP5 [Cuc... 57 5e-06 ref|XP_008439714.1| PREDICTED: uncharacterized protein LOC103484... 57 5e-06 ref|XP_008225255.1| PREDICTED: uncharacterized protein LOC103324... 57 6e-06 ref|XP_004309635.1| PREDICTED: transcription repressor OFP5 [Fra... 57 6e-06 ref|XP_009402214.1| PREDICTED: transcription repressor OFP1-like... 56 8e-06 >ref|XP_010248390.1| PREDICTED: transcription repressor OFP5-like [Nelumbo nucifera] Length = 457 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFEQ 109 ENLLACYLSLNSDE+H +I++ FRQVWFD+ Q S E ++ Sbjct: 414 ENLLACYLSLNSDEYHDLIVKVFRQVWFDMSQFCSSPELQR 454 >ref|XP_002305721.2| ovate family protein [Populus trichocarpa] gi|550340428|gb|EEE86232.2| ovate family protein [Populus trichocarpa] Length = 431 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFEQGISYSK 91 E LLACYL+LN+DE+H +I++ FRQVWFDL + SD+E E Y + Sbjct: 385 EELLACYLTLNADEYHDLIVKVFRQVWFDLNEACSDTELENEQGYDE 431 >ref|XP_010916741.1| PREDICTED: transcription repressor OFP7-like [Elaeis guineensis] Length = 368 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQD--SSDSEFEQG 106 E LLACYL LNSDEHH +I+E FRQVW DL ++ S+SE E+G Sbjct: 316 EGLLACYLCLNSDEHHDVIVEVFRQVWLDLTRERFRSESESERG 359 >ref|XP_011010911.1| PREDICTED: transcription repressor OFP5-like [Populus euphratica] Length = 439 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFEQGISYSK 91 E LLACYL+LN+DE+H +I++ FRQVWFDL + D+E E SY + Sbjct: 393 EELLACYLTLNADEYHDLIVKVFRQVWFDLNEACFDTELENEQSYDE 439 >ref|XP_011033512.1| PREDICTED: transcription repressor OFP5-like [Populus euphratica] Length = 439 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFEQGISYSK 91 E LLACYL+LN+DE+H +I++ FRQVWFDL + D+E E SY + Sbjct: 393 EELLACYLTLNADEYHDLIVKVFRQVWFDLNEACFDTELENEQSYDE 439 >ref|XP_012091839.1| PREDICTED: transcription repressor OFP5 [Jatropha curcas] gi|643704081|gb|KDP21145.1| hypothetical protein JCGZ_21616 [Jatropha curcas] Length = 409 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFE 112 E LLACYL+LNSDE+H +I+ FRQVWFDL Q D+E E Sbjct: 367 EELLACYLTLNSDEYHDLIIRVFRQVWFDLNQACFDTELE 406 >ref|XP_009406773.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata subsp. malaccensis] Length = 320 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSD 124 E+LLACYLSLNSDEHH +I++ FRQVWF+L Q D Sbjct: 276 ESLLACYLSLNSDEHHDVIVKVFRQVWFELSQSPID 311 >ref|XP_008790074.1| PREDICTED: transcription repressor OFP3-like [Phoenix dactylifera] Length = 393 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 4/50 (8%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQD----SSDSEFEQGISYS 94 E LLACYL +NSDEHH +I++ FRQVW DLI++ S+SE E G S S Sbjct: 336 EGLLACYLYVNSDEHHDVIVKVFRQVWLDLIRERFGSESESESELGDSCS 385 >ref|XP_010925176.1| PREDICTED: transcription repressor OFP5-like [Elaeis guineensis] Length = 353 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDL 142 E+LLACYLSLNSDEHH +I++ FRQVWFDL Sbjct: 312 ESLLACYLSLNSDEHHDVIVKVFRQVWFDL 341 >ref|XP_010917398.1| PREDICTED: transcription repressor OFP5-like [Elaeis guineensis] Length = 366 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDL 142 E+LLACYLSLNSDEHH +I++ FRQVWFDL Sbjct: 325 ESLLACYLSLNSDEHHDVIVKVFRQVWFDL 354 >ref|XP_010242153.1| PREDICTED: transcription repressor OFP3-like [Nelumbo nucifera] Length = 484 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSS 127 ENLLACYLSLNSDE+H +I++ FRQVWF+L Q S Sbjct: 448 ENLLACYLSLNSDEYHDLIIKVFRQVWFELKQSCS 482 >ref|XP_008777736.1| PREDICTED: transcription repressor OFP5-like [Phoenix dactylifera] Length = 372 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDL 142 E+LLACYLSLNSDEHH +I++ FRQVWFDL Sbjct: 331 ESLLACYLSLNSDEHHDVIVKVFRQVWFDL 360 >ref|XP_008792401.1| PREDICTED: transcription repressor OFP5-like [Phoenix dactylifera] Length = 370 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDL 142 E+LLACYLSLNSDEHH +I++ FRQVWFDL Sbjct: 329 ESLLACYLSLNSDEHHDVIVKVFRQVWFDL 358 >ref|XP_007213877.1| hypothetical protein PRUPE_ppa006822mg [Prunus persica] gi|462409742|gb|EMJ15076.1| hypothetical protein PRUPE_ppa006822mg [Prunus persica] Length = 394 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFE 112 E LLACYL+LNSDE+H +I++ FRQVWFDL Q S +E + Sbjct: 348 EELLACYLTLNSDEYHDLIVKVFRQVWFDLNQASFSTELQ 387 >ref|XP_011658258.1| PREDICTED: transcription repressor OFP5 [Cucumis sativus] gi|700194127|gb|KGN49331.1| hypothetical protein Csa_6G520290 [Cucumis sativus] Length = 468 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFEQ 109 E LLACYL+LNSD++H +I++ FRQVWFDL Q + +SE + Sbjct: 419 EELLACYLTLNSDQYHDLIIKVFRQVWFDLNQAALESELHK 459 >ref|XP_008439714.1| PREDICTED: uncharacterized protein LOC103484429 [Cucumis melo] Length = 468 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFEQ 109 E LLACYL+LNSD++H +I++ FRQVWFDL Q + +SE + Sbjct: 419 EELLACYLTLNSDQYHDLIIKVFRQVWFDLNQAALESELHK 459 >ref|XP_008225255.1| PREDICTED: uncharacterized protein LOC103324921 [Prunus mume] Length = 415 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSE 118 E LLACYL+LNSDE+H +I++ FRQVWFDL Q S +E Sbjct: 369 EELLACYLTLNSDEYHDLIVKVFRQVWFDLNQASFSTE 406 >ref|XP_004309635.1| PREDICTED: transcription repressor OFP5 [Fragaria vesca subsp. vesca] Length = 212 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQDSSDSEFE 112 E LLACYL+LNSDE+H +I++ FRQVWFDL Q SE + Sbjct: 166 EELLACYLTLNSDEYHDLIIKVFRQVWFDLNQTYFGSELQ 205 >ref|XP_009402214.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata subsp. malaccensis] Length = 393 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -2 Query: 231 ENLLACYLSLNSDEHHGIILEAFRQVWFDLIQ 136 E LLACYLSLNSDE+H +I++AF+Q+WFDL Q Sbjct: 358 EELLACYLSLNSDEYHDVIVKAFQQIWFDLCQ 389