BLASTX nr result
ID: Cinnamomum23_contig00057164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057164 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM89646.1| hypothetical protein ANO11243_076850 [fungal sp.... 67 5e-09 >dbj|GAM89646.1| hypothetical protein ANO11243_076850 [fungal sp. No.11243] Length = 329 Score = 67.0 bits (162), Expect = 5e-09 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 3/69 (4%) Frame = -1 Query: 198 YVNPDSYNPTSGGVGYAGQGQYRSQPPPKYG---VAQFDTPSKKTPDGPGADALPAMPSW 28 Y P +N GY QGQYRSQ PP YG A F++P+K G DALPAMPSW Sbjct: 26 YCKPSDFN-----TGYPPQGQYRSQAPPHYGPPATATFESPAKTARYG-NEDALPAMPSW 79 Query: 27 SDARSRKVE 1 SDA+SR++E Sbjct: 80 SDAQSRRIE 88