BLASTX nr result
ID: Cinnamomum23_contig00057091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057091 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM90322.1| hypothetical protein ANO11243_083650 [fungal sp.... 72 1e-10 gb|KKY28637.1| putative superoxide dismutase [Phaeomoniella chla... 58 2e-06 >dbj|GAM90322.1| hypothetical protein ANO11243_083650 [fungal sp. No.11243] Length = 283 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -3 Query: 170 YQAVLPPTNFDNGTGSTVTGDIIISSKAGGSGVSVNVNFKGLPSQAMYGPFVYHIH 3 Y A LP T F+ TG+TV+G I ISSK G +GV+V+VNF PS + YGPFVYHIH Sbjct: 80 YVATLPSTAFNELTGTTVSGSISISSKQGDTGVTVSVNFANFPSVSQYGPFVYHIH 135 >gb|KKY28637.1| putative superoxide dismutase [Phaeomoniella chlamydospora] Length = 231 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = -3 Query: 170 YQAVLPPTNFDNGTGSTVTGDIIISSKAGGSGVSVNVNFKGLPSQAMYGPFVYHIH 3 YQAVLP N +T+ G I +S G+GV N+NF GLP Q+ GPF+YHIH Sbjct: 38 YQAVLP-----NKNTTTIRGQITGTSNTNGTGVEFNINFYGLPDQSQGGPFIYHIH 88