BLASTX nr result
ID: Cinnamomum23_contig00057082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057082 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624492.1| Pentatricopeptide repeat-containing protein ... 102 8e-20 ref|XP_004493071.1| PREDICTED: putative pentatricopeptide repeat... 102 1e-19 ref|XP_010249212.1| PREDICTED: putative pentatricopeptide repeat... 96 7e-18 ref|XP_008231187.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-17 ref|XP_003553304.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-17 gb|KHM99218.1| Putative pentatricopeptide repeat-containing prot... 94 3e-17 ref|XP_006468886.1| PREDICTED: putative pentatricopeptide repeat... 94 3e-17 ref|XP_006446942.1| hypothetical protein CICLE_v10014272mg [Citr... 94 3e-17 ref|XP_010660688.1| PREDICTED: putative pentatricopeptide repeat... 92 1e-16 emb|CBI21281.3| unnamed protein product [Vitis vinifera] 92 1e-16 ref|XP_008802215.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_009125145.1| PREDICTED: putative pentatricopeptide repeat... 91 2e-16 ref|XP_012446550.1| PREDICTED: putative pentatricopeptide repeat... 91 3e-16 ref|XP_008379741.1| PREDICTED: putative pentatricopeptide repeat... 91 3e-16 ref|XP_006292165.1| hypothetical protein CARUB_v10018371mg, part... 91 3e-16 emb|CDX67462.1| BnaA07g15020D [Brassica napus] 90 5e-16 ref|XP_010496418.1| PREDICTED: putative pentatricopeptide repeat... 90 7e-16 ref|XP_012446558.1| PREDICTED: putative pentatricopeptide repeat... 89 9e-16 ref|XP_010682975.1| PREDICTED: putative pentatricopeptide repeat... 89 9e-16 emb|CDY11692.1| BnaC06g13000D [Brassica napus] 89 1e-15 >ref|XP_003624492.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1125 Score = 102 bits (255), Expect = 8e-20 Identities = 46/64 (71%), Positives = 57/64 (89%) Frame = -1 Query: 192 HVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSG 13 HVDA +IKTGFNPNTYRSN L++S LQRG+L+ AR+LFDEMPH+N STNT+I G++KSG Sbjct: 87 HVDASIIKTGFNPNTYRSNFLVKSFLQRGDLNGARKLFDEMPHKNIFSTNTMIMGYIKSG 146 Query: 12 NLSD 1 NLS+ Sbjct: 147 NLSE 150 >ref|XP_004493071.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Cicer arietinum] Length = 812 Score = 102 bits (253), Expect = 1e-19 Identities = 45/64 (70%), Positives = 57/64 (89%) Frame = -1 Query: 192 HVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSG 13 HVDA +IKTGF+PNTYRSN L+++ LQRG+LS AR+LFDEMPH+N STNT+I G++KSG Sbjct: 25 HVDASIIKTGFDPNTYRSNFLLKAFLQRGDLSHARKLFDEMPHKNIFSTNTMIMGYIKSG 84 Query: 12 NLSD 1 NLS+ Sbjct: 85 NLSE 88 >ref|XP_010249212.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Nelumbo nucifera] gi|719978600|ref|XP_010249214.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Nelumbo nucifera] gi|719978605|ref|XP_010249215.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Nelumbo nucifera] Length = 818 Score = 96.3 bits (238), Expect = 7e-18 Identities = 47/62 (75%), Positives = 53/62 (85%) Frame = -1 Query: 189 VDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSGN 10 VDA MIKTGFNP+ RSN+LME L+RG L +ARQLFD+MP RN ISTNTLISG+VKSGN Sbjct: 32 VDAHMIKTGFNPSICRSNYLMEDCLKRGHLLKARQLFDQMPQRNVISTNTLISGYVKSGN 91 Query: 9 LS 4 LS Sbjct: 92 LS 93 >ref|XP_008231187.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Prunus mume] Length = 899 Score = 95.1 bits (235), Expect = 2e-17 Identities = 56/118 (47%), Positives = 73/118 (61%), Gaps = 15/118 (12%) Frame = -1 Query: 315 SFRSFLH------QPMTLLLRAHAFYHFAPII---------PAIFPKCHRHLSLLQHVDA 181 SFR LH Q T + R AF A + P P + +L+ +VDA Sbjct: 56 SFRCSLHLHDNEAQTSTTIFRMTAFRSNALLKFRTPRVSEPPKAKPLLNLNLNAQNYVDA 115 Query: 180 QMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSGNL 7 +MIKTGF+PN RSN L+++ L+RGELSQAR LFD+MPH+NT+STN +IS +V SGNL Sbjct: 116 RMIKTGFDPNICRSNFLVKNFLKRGELSQARILFDQMPHKNTVSTNMMISSYVNSGNL 173 >ref|XP_003553304.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Glycine max] Length = 815 Score = 95.1 bits (235), Expect = 2e-17 Identities = 47/74 (63%), Positives = 57/74 (77%) Frame = -1 Query: 225 PKCHRHLSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTIST 46 PK H QHVDA MIKTGF+PNT R N +++ LQRG+L AR+LFDEMPH+N IST Sbjct: 22 PKRH-----FQHVDASMIKTGFDPNTCRFNFQVQTHLQRGDLGAARKLFDEMPHKNVIST 76 Query: 45 NTLISGFVKSGNLS 4 NT+I G++KSGNLS Sbjct: 77 NTMIMGYLKSGNLS 90 >gb|KHM99218.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 765 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/70 (65%), Positives = 56/70 (80%) Frame = -1 Query: 213 RHLSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLI 34 RHL +VDA MIKTGF+PNTYR N ++ LQRG+L AR+LFDEMPH+N ISTNT+I Sbjct: 20 RHL----YVDASMIKTGFDPNTYRYNFQVQIHLQRGDLGAARKLFDEMPHKNVISTNTMI 75 Query: 33 SGFVKSGNLS 4 G++KSGNLS Sbjct: 76 MGYIKSGNLS 85 >ref|XP_006468886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Citrus sinensis] Length = 828 Score = 94.0 bits (232), Expect = 3e-17 Identities = 42/62 (67%), Positives = 59/62 (95%) Frame = -1 Query: 189 VDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSGN 10 VDA++IKTGF+PNT RSN ++++L++RG+LS+AR+LFDEMP++NT+STN LISG+VKSGN Sbjct: 41 VDARIIKTGFDPNTCRSNFVVDNLIRRGQLSEARKLFDEMPNQNTVSTNMLISGYVKSGN 100 Query: 9 LS 4 L+ Sbjct: 101 LA 102 >ref|XP_006446942.1| hypothetical protein CICLE_v10014272mg [Citrus clementina] gi|557549553|gb|ESR60182.1| hypothetical protein CICLE_v10014272mg [Citrus clementina] Length = 830 Score = 94.0 bits (232), Expect = 3e-17 Identities = 42/62 (67%), Positives = 59/62 (95%) Frame = -1 Query: 189 VDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSGN 10 VDA++IKTGF+PNT RSN ++++L++RG+LS+AR+LFDEMP++NT+STN LISG+VKSGN Sbjct: 43 VDARIIKTGFDPNTCRSNFVVDNLIRRGQLSEARKLFDEMPNQNTVSTNMLISGYVKSGN 102 Query: 9 LS 4 L+ Sbjct: 103 LA 104 >ref|XP_010660688.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Vitis vinifera] Length = 784 Score = 92.4 bits (228), Expect = 1e-16 Identities = 40/69 (57%), Positives = 60/69 (86%) Frame = -1 Query: 207 LSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISG 28 L+++ ++DA+++KTGF+P+T RSN + + L+ GELSQARQLF++MPH+NT+STN +ISG Sbjct: 28 LNVVNNIDARIVKTGFDPDTSRSNFRVGNFLKNGELSQARQLFEKMPHKNTVSTNMMISG 87 Query: 27 FVKSGNLSD 1 +VKSGNL + Sbjct: 88 YVKSGNLGE 96 >emb|CBI21281.3| unnamed protein product [Vitis vinifera] Length = 785 Score = 92.4 bits (228), Expect = 1e-16 Identities = 40/69 (57%), Positives = 60/69 (86%) Frame = -1 Query: 207 LSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISG 28 L+++ ++DA+++KTGF+P+T RSN + + L+ GELSQARQLF++MPH+NT+STN +ISG Sbjct: 28 LNVVNNIDARIVKTGFDPDTSRSNFRVGNFLKNGELSQARQLFEKMPHKNTVSTNMMISG 87 Query: 27 FVKSGNLSD 1 +VKSGNL + Sbjct: 88 YVKSGNLGE 96 >ref|XP_008802215.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Phoenix dactylifera] gi|672164664|ref|XP_008802216.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Phoenix dactylifera] gi|672164666|ref|XP_008802217.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Phoenix dactylifera] Length = 816 Score = 91.7 bits (226), Expect = 2e-16 Identities = 44/72 (61%), Positives = 55/72 (76%) Frame = -1 Query: 216 HRHLSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTL 37 + L L VDAQMIKTGF+ TY +NHL+ESLL GELS+ARQLFDEMP RN ++N + Sbjct: 22 YHKLPLQNRVDAQMIKTGFDLQTYHTNHLLESLLSNGELSKARQLFDEMPIRNIFTSNRM 81 Query: 36 ISGFVKSGNLSD 1 ISG+ KSG+L + Sbjct: 82 ISGYAKSGDLGE 93 >ref|XP_009125145.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Brassica rapa] Length = 812 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 2/72 (2%) Frame = -1 Query: 213 RHLSLLQ--HVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNT 40 +HL LQ +DA++IKTGFN +T RSN ++E L+ G++S AR++FDEMPH+NT+STNT Sbjct: 17 QHLRFLQTPRIDARIIKTGFNTDTCRSNFILEDFLRGGQVSSARKVFDEMPHKNTVSTNT 76 Query: 39 LISGFVKSGNLS 4 +ISG+VKSG++S Sbjct: 77 MISGYVKSGDVS 88 >ref|XP_012446550.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 isoform X1 [Gossypium raimondii] Length = 889 Score = 90.9 bits (224), Expect = 3e-16 Identities = 48/98 (48%), Positives = 72/98 (73%), Gaps = 4/98 (4%) Frame = -1 Query: 288 MTLLLR----AHAFYHFAPIIPAIFPKCHRHLSLLQHVDAQMIKTGFNPNTYRSNHLMES 121 +TLL++ A A +F+ + P+ P +++ +DA+ IKTGF+PNT RSN ++E+ Sbjct: 70 LTLLMKPYRPAFALKNFSSLAPSKPPISVQNVETF--IDARSIKTGFDPNTCRSNFMVEN 127 Query: 120 LLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSGNL 7 LL++G LS ARQ+FD+MP RNT+STN +ISG+VKSG+L Sbjct: 128 LLRKGYLSTARQVFDQMPSRNTVSTNMMISGYVKSGDL 165 >ref|XP_008379741.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Malus domestica] Length = 826 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/74 (58%), Positives = 59/74 (79%) Frame = -1 Query: 225 PKCHRHLSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTIST 46 P + +L+ VDA++IKTGF+ +T RSN L+++ L RGELS+ARQLFD+MPH+NT+ST Sbjct: 28 PFLNPNLNAQNSVDARLIKTGFDAHTCRSNFLVKNFLNRGELSRARQLFDQMPHKNTVST 87 Query: 45 NTLISGFVKSGNLS 4 N +IS +V SGNLS Sbjct: 88 NMMISSYVNSGNLS 101 >ref|XP_006292165.1| hypothetical protein CARUB_v10018371mg, partial [Capsella rubella] gi|482560872|gb|EOA25063.1| hypothetical protein CARUB_v10018371mg, partial [Capsella rubella] Length = 849 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/70 (58%), Positives = 60/70 (85%) Frame = -1 Query: 213 RHLSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLI 34 R L L +DA++IKTGF+ +T RSN ++E+LL+RG++S AR L+DEMPH+NT+STNT+I Sbjct: 53 RPLYLDTRIDARIIKTGFDTDTCRSNFIVENLLRRGQVSAARNLYDEMPHKNTVSTNTMI 112 Query: 33 SGFVKSGNLS 4 SG++K+G+LS Sbjct: 113 SGYIKTGDLS 122 >emb|CDX67462.1| BnaA07g15020D [Brassica napus] Length = 784 Score = 90.1 bits (222), Expect = 5e-16 Identities = 41/72 (56%), Positives = 60/72 (83%), Gaps = 2/72 (2%) Frame = -1 Query: 213 RHLSLLQ--HVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNT 40 +HL LQ +DA++IKTGFN +T RSN ++E L+ G++S AR+++DEMPH+NT+STNT Sbjct: 17 QHLRFLQTPRIDARIIKTGFNTDTCRSNFILEDFLRGGQVSSARKVYDEMPHKNTVSTNT 76 Query: 39 LISGFVKSGNLS 4 +ISG+VKSG++S Sbjct: 77 MISGYVKSGDVS 88 >ref|XP_010496418.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Camelina sativa] Length = 826 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/78 (56%), Positives = 62/78 (79%) Frame = -1 Query: 237 PAIFPKCHRHLSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRN 58 PAIF L VDA++IKTGF+ +T RSN +++ LL+RG++S AR++FDEMPH+N Sbjct: 31 PAIF--------LNTRVDARIIKTGFDTDTCRSNFIVDDLLRRGQVSAARKVFDEMPHKN 82 Query: 57 TISTNTLISGFVKSGNLS 4 T+STNT+ISG+VK+G+LS Sbjct: 83 TVSTNTMISGYVKTGDLS 100 >ref|XP_012446558.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 isoform X2 [Gossypium raimondii] gi|763744260|gb|KJB11759.1| hypothetical protein B456_001G275900 [Gossypium raimondii] Length = 818 Score = 89.4 bits (220), Expect = 9e-16 Identities = 45/88 (51%), Positives = 66/88 (75%) Frame = -1 Query: 270 AHAFYHFAPIIPAIFPKCHRHLSLLQHVDAQMIKTGFNPNTYRSNHLMESLLQRGELSQA 91 A A +F+ + P+ P +++ +DA+ IKTGF+PNT RSN ++E+LL++G LS A Sbjct: 7 AFALKNFSSLAPSKPPISVQNVETF--IDARSIKTGFDPNTCRSNFMVENLLRKGYLSTA 64 Query: 90 RQLFDEMPHRNTISTNTLISGFVKSGNL 7 RQ+FD+MP RNT+STN +ISG+VKSG+L Sbjct: 65 RQVFDQMPSRNTVSTNMMISGYVKSGDL 92 >ref|XP_010682975.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510 [Beta vulgaris subsp. vulgaris] gi|870855120|gb|KMT06853.1| hypothetical protein BVRB_6g151940 [Beta vulgaris subsp. vulgaris] Length = 819 Score = 89.4 bits (220), Expect = 9e-16 Identities = 41/61 (67%), Positives = 54/61 (88%) Frame = -1 Query: 189 VDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSGN 10 +DA++IKTGFNPNT R+N ME+L++ G+L++ARQLFDEMP+RN S NTL+SG+VKSGN Sbjct: 34 IDARIIKTGFNPNTSRTNFEMENLIKCGQLTKARQLFDEMPNRNMFSLNTLLSGYVKSGN 93 Query: 9 L 7 L Sbjct: 94 L 94 >emb|CDY11692.1| BnaC06g13000D [Brassica napus] Length = 812 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/62 (61%), Positives = 55/62 (88%) Frame = -1 Query: 189 VDAQMIKTGFNPNTYRSNHLMESLLQRGELSQARQLFDEMPHRNTISTNTLISGFVKSGN 10 +DA++IKTGFN +T RSN ++E L+RG++S AR+++DEMPH+NT+STNT+ISG+VKSG Sbjct: 27 IDARIIKTGFNTDTCRSNFILEDFLRRGQVSAARKVYDEMPHKNTVSTNTMISGYVKSGE 86 Query: 9 LS 4 +S Sbjct: 87 VS 88