BLASTX nr result
ID: Cinnamomum23_contig00057075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057075 (219 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443056.1| hypothetical protein CICLE_v10023746mg [Citr... 57 6e-06 >ref|XP_006443056.1| hypothetical protein CICLE_v10023746mg [Citrus clementina] gi|557545318|gb|ESR56296.1| hypothetical protein CICLE_v10023746mg [Citrus clementina] Length = 174 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 217 FPKHALRNVSRNRVVIESDVPVPATVYVWVDQASVS 110 FP HALRNVS NRVVIESDV VPATV+V VDQ S Sbjct: 139 FPNHALRNVSENRVVIESDVAVPATVFVTVDQGVTS 174