BLASTX nr result
ID: Cinnamomum23_contig00057068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00057068 (251 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007783809.1| hypothetical protein W97_07702 [Coniosporium... 66 8e-09 gb|KIW09560.1| hypothetical protein PV09_00433 [Verruconis gallo... 62 1e-07 >ref|XP_007783809.1| hypothetical protein W97_07702 [Coniosporium apollinis CBS 100218] gi|494832156|gb|EON68492.1| hypothetical protein W97_07702 [Coniosporium apollinis CBS 100218] Length = 747 Score = 66.2 bits (160), Expect = 8e-09 Identities = 36/62 (58%), Positives = 41/62 (66%) Frame = -3 Query: 186 AMVNTTFSRLGDLNPMKLPFIRTSFQSYERLPVYGDKKHTSPFSTPSLKKYRWRSPSPGS 7 +M SR +LNP+KL + SYERLP Y D + SPF TP LKKYRWRSPSPGS Sbjct: 38 SMTTRLSSRFAELNPLKLLPVGEK-GSYERLPGY-DSANGSPFGTPILKKYRWRSPSPGS 95 Query: 6 DR 1 DR Sbjct: 96 DR 97 >gb|KIW09560.1| hypothetical protein PV09_00433 [Verruconis gallopava] Length = 724 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = -3 Query: 165 SRLGDLNPMKLPFIRTSFQSYERLPVYGDKKHTSPFSTPSLKKYRWRSPSPGSDR 1 +R+ LNP+KL I+T+F+ YE+LP Y + SP+ST SLKKYRWRSPSPG +R Sbjct: 9 ARVASLNPLKLLPIKTNFK-YEQLPGY-ESNAGSPYSTLSLKKYRWRSPSPGGER 61