BLASTX nr result
ID: Cinnamomum23_contig00056935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00056935 (476 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007681586.1| hypothetical protein BAUCODRAFT_315415 [Baud... 72 1e-10 >ref|XP_007681586.1| hypothetical protein BAUCODRAFT_315415 [Baudoinia compniacensis UAMH 10762] gi|449295096|gb|EMC91118.1| hypothetical protein BAUCODRAFT_315415 [Baudoinia compniacensis UAMH 10762] Length = 356 Score = 72.0 bits (175), Expect = 1e-10 Identities = 37/60 (61%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = +3 Query: 135 TGSRSPTKR-DRTNSPKGNTPSPPGRPPTTQQVDFEFLNFSHPSDAKASQARRRVRSHVT 311 +GSR+ T R+ + G+ PS PG P T Q+DF+FLNFSHPSDAKAS+ARR VRSHVT Sbjct: 15 SGSRAATPALSRSETSSGSKPSTPGEP-TRNQIDFQFLNFSHPSDAKASRARRTVRSHVT 73