BLASTX nr result
ID: Cinnamomum23_contig00056898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00056898 (242 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN11393.1| hypothetical protein AMTR_s00176p00065670 [Ambore... 66 8e-09 >gb|ERN11393.1| hypothetical protein AMTR_s00176p00065670 [Amborella trichopoda] Length = 259 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -3 Query: 168 DFTRKKRILARGTELPTCITNGKTQLKTVYVFAKQSFVILRVRTKHLGGAFTT 10 D T + LA G +LPTC NGKT+LK VY++ KQS V LR+R KH GG FTT Sbjct: 135 DLTLNCQALAMGRDLPTCTENGKTKLKRVYIYMKQSHVFLRLRNKHWGGIFTT 187