BLASTX nr result
ID: Cinnamomum23_contig00056853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00056853 (308 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010938595.1| PREDICTED: probable ADP-ribosylation factor ... 64 5e-08 >ref|XP_010938595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11 isoform X3 [Elaeis guineensis] Length = 298 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 307 NLNPVWNERLMLAIPDPIPPLKLVSWCYLVKHNPFLKNK*NTQIH 173 +LNP+WNERLML+IPDPIPPLKLVSW L++ + +K T+IH Sbjct: 243 SLNPIWNERLMLSIPDPIPPLKLVSWSLLLQKQNAVISKYTTRIH 287