BLASTX nr result
ID: Cinnamomum23_contig00056841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00056841 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010089122.1| Putative copper-transporting ATPase 3 [Morus... 57 4e-06 >ref|XP_010089122.1| Putative copper-transporting ATPase 3 [Morus notabilis] gi|587846929|gb|EXB37369.1| Putative copper-transporting ATPase 3 [Morus notabilis] Length = 989 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -1 Query: 157 SSKMLALSCFRSETSSESRDFSPRPHYPSMPKYPKGFALKK 35 ++K+LAL+C R+E+ S SPRPHYPSMPKYPKG A ++ Sbjct: 2 AAKLLALACIRNESRGGSSGLSPRPHYPSMPKYPKGVAAEE 42