BLASTX nr result
ID: Cinnamomum23_contig00056108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00056108 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007780118.1| hypothetical protein W97_04034 [Coniosporium... 56 8e-06 >ref|XP_007780118.1| hypothetical protein W97_04034 [Coniosporium apollinis CBS 100218] gi|494827905|gb|EON64801.1| hypothetical protein W97_04034 [Coniosporium apollinis CBS 100218] Length = 654 Score = 56.2 bits (134), Expect = 8e-06 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Frame = -2 Query: 280 KDFASMESSSNKLDIPRPWTSASDISPRASVSTLSSIHSSFS-KLTSDSIFSRRPSSGSQ 104 KD + + ++ + R W A+D ++ ST SS S +S + +DS+ SRR S+ S Sbjct: 12 KDVLIPDDAGSRSNASRAWNPAAD-KDASTASTTSSRSSLYSVRSMTDSMLSRRSSTTSY 70 Query: 103 ASAITLDSYFENAPTLVKTPWELERSKKP 17 + + E PTL +TPWELER+K+P Sbjct: 71 TGSSVYSANMEIVPTLTRTPWELERNKRP 99