BLASTX nr result
ID: Cinnamomum23_contig00056017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00056017 (515 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003854542.1| hypothetical protein MYCGRDRAFT_69513 [Zymos... 60 4e-07 >ref|XP_003854542.1| hypothetical protein MYCGRDRAFT_69513 [Zymoseptoria tritici IPO323] gi|339474425|gb|EGP89518.1| hypothetical protein MYCGRDRAFT_69513 [Zymoseptoria tritici IPO323] Length = 743 Score = 60.5 bits (145), Expect = 4e-07 Identities = 34/63 (53%), Positives = 38/63 (60%) Frame = -2 Query: 511 DRSHASPSASDLGSRTGSPARVAHHGHHSSARGTSPGTFGYPYHHHKRDGYLSDSPAPTA 332 DR SP+ S SR+ SP S R SP +FGYPYH H RDGYLSD+P PTA Sbjct: 684 DRVAYSPNRSPFISRSSSPGPATVRD--LSLRSASPVSFGYPYHSH-RDGYLSDTPTPTA 740 Query: 331 IRG 323 IRG Sbjct: 741 IRG 743