BLASTX nr result
ID: Cinnamomum23_contig00055964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00055964 (344 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382338.1| hypothetical protein POPTR_0005s01170g, part... 49 5e-08 >ref|XP_006382338.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa] gi|550337696|gb|ERP60135.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa] Length = 270 Score = 48.5 bits (114), Expect(2) = 5e-08 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +3 Query: 96 VWCAHGKLETIELQNNFFLFNFTSSQNLARTRSASPWKIAGHQLALTSWH 245 +W G L ++L N+FFL F++ ++ S PW +A H L + SWH Sbjct: 98 IWKIQGDLNLVDLGNDFFLARFSNKEDRESAMSGGPWMVADHYLTMRSWH 147 Score = 35.0 bits (79), Expect(2) = 5e-08 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +2 Query: 245 PNFDPLTMVIEQLPVWIMLPRLLTEY 322 PNFDP IE++ VWI LP L EY Sbjct: 148 PNFDPNVATIEKVAVWIRLPDLAMEY 173